DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6839 and CG33346

DIOPT Version :8

Sequence 1:NP_649076.1 Gene:CG6839 / 40067 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_996301.2 Gene:CG33346 / 2768690 FlyBaseID:FBgn0053346 Length:364 Species:Drosophila melanogaster

Alignment Length:267 Identity:69/267 - (25%)
Similarity:116/267 - (43%) Gaps:31/267 - (11%)


  Fly   160 VGFEITSSRFAEQMQICFNEEEEVTRYTRHKLEPGSNYYETGVARITFQTAGFFDGKNVDKLYTQ 224
            |||:. .:.|.|..:.|::.......::.:.:      |.|.:......|.  ||...:.....:
  Fly   114 VGFKY-GNTFMELYRSCYDARTMKAYFSINTV------YPTNLKSDRPPTV--FDKDGIITPADE 169

  Fly   225 AT-QLETINNE---LGGDAEKYFDSSSNVYLARGHLGAKADFDYAPEQRATFLFINAAPQWQTFN 285
            || |:.:|.|.   |.|..:.|..||.::...||||...||:.:....|.|..::|..||:...|
  Fly   170 ATFQMNSIYNRFEYLFGSGQTYVPSSRSLSFDRGHLTPVADYSFPKILRQTNKYLNVVPQYYNIN 234

  Fly   286 AGNWARVEDGLRAWVSKNKLNVNCYTGVYGVTTLPNKDGVETPLYLAKDDNNNGLIPVPKLYFRV 350
            ..||..||:    ||...|..:|..||..||..|.|:......:|||.:.|     |||:..:::
  Fly   235 RSNWKIVEN----WVRGQKDVLNVCTGALGVLDLLNRSQKSVSIYLAPNKN-----PVPRWTYKI 290

  Fly   351 VIDPSSHRGIVFVGVNNPHLTEEQIKRDYVICDDVSDQVTYINWKTTDIKAGWSYACEVADFLKT 415
            :  .|...||.:|.:.:.:..|.|......:|     :||...........|:::.|:..||:: 
  Fly   291 I--RSLTTGIKYVILTSNNGWETQQPNPASVC-----KVTACPRTLNPTGTGYTFCCDPIDFIR- 347

  Fly   416 VKHLPAL 422
             :::|.|
  Fly   348 -RNVPNL 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6839NP_649076.1 NUC 170..420 CDD:238043 63/253 (25%)
CG33346NP_996301.2 Endonuclease_NS 124..344 CDD:214889 61/243 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2215546
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005351
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13966
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.