DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14077 and cox6a2

Sequence 1:NP_001246828.1 Gene:CG14077 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001004884.1 Gene:cox6a2 XenbaseID:XB-GENE-5784173 Length:105 Species:Xenopus tropicalis

Alignment Length:78 Identity:30/79 (38%)
Similarity:46/79 (58%) Gaps:3/79 (4%)


  Fly   155 AQHSKLWQKISLFGVLPMIAILTLLVFSTRSE--EERLEFKNYEHMYRRTKRYWFKDGNRTAFHN 217
            |:.::.|:.:|....||.:|:..|..:..:..  .||.:|..|:|:..||||:.:.|||.:.|||
 Frog    26 AKAARTWKILSFTVALPGVAVCMLNAWLKKQHHPHERPKFVAYDHLRIRTKRFPWGDGNHSFFHN 90

  Fly   218 SHFNALPPAGYED 230
            .|.|.| |||||:
 Frog    91 PHANPL-PAGYEE 102

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 29/76 (38%)
cox6a2NP_001004884.1 Cyt_c_Oxidase_VIa 15..101 CDD:238465 29/76 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2305997
eggNOG 1 0.900 E1_KOG3469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1591077at2759
OrthoFinder 1 1.000 FOG0001314
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.