DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14077 and levy

DIOPT Version :9

Sequence 1:NP_001246828.1 Gene:CG14077 / 40066 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001286770.1 Gene:levy / 37728 FlyBaseID:FBgn0034877 Length:109 Species:Drosophila melanogaster


Alignment Length:83 Identity:30/83 - (36%)
Similarity:48/83 - (57%) Gaps:7/83 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 IVAQHS---KLWQKISLFGVLPMIAILTLLVFSTRSEEE---RLEFKNYEHMYRRTKRYWFKDGN 211
            :..:||   |:|:::|.|..:|.:.:..|..:....||.   |.||..|:::.||.||:.:.:|.
  Fly    27 VAGEHSGGYKVWKRLSFFVAVPAVGLCMLNAYLKHQEEHDKPRQEFVKYDYLRRREKRFPWGEGQ 91

  Fly   212 RTAFHNSHFNALPPAGYE 229
            ::.|||.|.||||. |||
  Fly    92 KSLFHNPHVNALPD-GYE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 28/81 (35%)
levyNP_001286770.1 Cyt_c_Oxidase_VIa 24..108 CDD:238465 28/81 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468263
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3469
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1430
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D135527at33392
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11504
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.