DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14077 and levy

Sequence 1:NP_001246828.1 Gene:CG14077 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001286770.1 Gene:levy FlyBaseID:FBgn0034877 Length:109 Species:Drosophila melanogaster

Alignment Length:83 Identity:30/84 (36%)
Similarity:48/84 (57%) Gaps:7/84 (8%)


  Fly   153 IVAQHS---KLWQKISLFGVLPMIAILTLLVFSTRSEEE---RLEFKNYEHMYRRTKRYWFKDGN 211
            :..:||   |:|:::|.|..:|.:.:..|..:....||.   |.||..|:::.||.||:.:.:|.
  Fly    27 VAGEHSGGYKVWKRLSFFVAVPAVGLCMLNAYLKHQEEHDKPRQEFVKYDYLRRREKRFPWGEGQ 91

  Fly   212 RTAFHNSHFNALPPAGYE 229
            ::.|||.|.||||. |||
  Fly    92 KSLFHNPHVNALPD-GYE 108

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 29/82 (35%)
levyNP_001286770.1 Cyt_c_Oxidase_VIa 24..108 CDD:238465 29/82 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2297201
eggNOG 1 0.900 E1_KOG3469
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1430
OrthoDB 1 1.010 D1591077at2759
OrthoFinder 1 1.000 FOG0001314
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11504
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.