powered by:
                  
 
    
 
    
             
          
            Protein Alignment CG14077 and cox6a1
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001246828.1 | 
            Gene: | CG14077 / 40066 | 
            FlyBaseID: | FBgn0036830 | 
            Length: | 289 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_001005592.1 | 
            Gene: | cox6a1 / 335774 | 
            ZFINID: | ZDB-GENE-030131-7715 | 
            Length: | 108 | 
            Species: | Danio rerio | 
          
        
        
        
          
            | Alignment Length: | 117 | 
            Identity: | 38/117 - (32%) | 
          
          
            | Similarity: | 57/117 -  (48%) | 
            Gaps: | 19/117 - (16%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly   122 LGKSTRKQKKPLTAIQGGDLGCPGRTGKKPQIVAQH----SKLWQKISLFGVLPMIAILTL-LVF 181 
            :|:.::|..|.....|...|.           .|.|    :|.|:.::....||.:|:..| :.. 
Zfish     4 VGRLSQKLFKSAALTQSRQLS-----------AAAHGENAAKTWKILTFVVALPGVAVCMLNMYL 57 
 
  Fly   182 STRSEEERLEFKNYEHMYRRTKRYWFKDGNRTAFHNSHFNALPPAGYE--DE 231 
            .::...|:.||..|.|:..|:||:.:.|||:|.|||.|.||||. |||  || 
Zfish    58 RSQHHHEQPEFVPYSHLRIRSKRFPWGDGNKTLFHNPHVNALPD-GYEHHDE 108 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            1 | 
            0.900 | 
            - | 
            - | 
             | 
            E1_KOG3469 | 
          
          
            | Hieranoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            1 | 
            1.010 | 
            - | 
            - | 
             | 
            D1591077at2759 | 
          
          
            | OrthoFinder | 
            1 | 
            1.000 | 
            - | 
            - | 
             | 
            FOG0001528 | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            1 | 
            1.100 | 
            - | 
            - | 
            O | 
            PTHR11504 | 
          
          
            | Phylome | 
            1 | 
            0.910 | 
            - | 
            - | 
             | 
             | 
          
          
            | RoundUp | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SwiftOrtho | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | TreeFam | 
            1 | 
            0.960 | 
            - | 
            - | 
             | 
             | 
          
          
            | ZFIN | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            6 | 5.880 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.