DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14077 and cox6a1

Sequence 1:NP_001246828.1 Gene:CG14077 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001005592.1 Gene:cox6a1 ZFINID:ZDB-GENE-030131-7715 Length:108 Species:Danio rerio

Alignment Length:117 Identity:38/118 (32%)
Similarity:57/118 (48%) Gaps:19/118 (16%)


  Fly   122 LGKSTRKQKKPLTAIQGGDLGCPGRTGKKPQIVAQH----SKLWQKISLFGVLPMIAILTL-LVF 181
            :|:.::|..|.....|...|.           .|.|    :|.|:.::....||.:|:..| :..
Zfish     4 VGRLSQKLFKSAALTQSRQLS-----------AAAHGENAAKTWKILTFVVALPGVAVCMLNMYL 57

  Fly   182 STRSEEERLEFKNYEHMYRRTKRYWFKDGNRTAFHNSHFNALPPAGYE--DE 231
            .::...|:.||..|.|:..|:||:.:.|||:|.|||.|.||||. |||  ||
Zfish    58 RSQHHHEQPEFVPYSHLRIRSKRFPWGDGNKTLFHNPHVNALPD-GYEHHDE 108

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 30/88 (34%)
cox6a1NP_001005592.1 Cyt_c_Oxidase_VIa 24..104 CDD:238465 30/92 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1591077at2759
OrthoFinder 1 1.000 FOG0001314
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11504
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.