DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6AL2 and cox13

DIOPT Version :10

Sequence 1:NP_649075.1 Gene:COX6AL2 / 40066 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_588417.1 Gene:cox13 / 2538807 PomBaseID:SPCC1739.09C Length:130 Species:Schizosaccharomyces pombe


Alignment Length:82 Identity:19/82 - (23%)
Similarity:36/82 - (43%) Gaps:10/82 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 QIVAQHSK----LWQKISLF--GVLPMIAILTLLVFSTRSEEERLEFKNYEHMYR----RTKRYW 206
            |...:|:|    .|:|::.:  |...::|.........:.:|.....::.:..|.    |.|:|.
pombe    44 QAEEEHAKRSSEFWKKVTYYIGGPALILASANAYYIYCKHQEHAKHVEDTDPGYSFENLRFKKYP 108

  Fly   207 FKDGNRTAFHNSHFNAL 223
            :.||::|.|.|...|.|
pombe   109 WGDGSKTLFWNDKVNHL 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6AL2NP_649075.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 19/82 (23%)
cox13NP_588417.1 Cyt_c_Oxidase_VIa 42..130 CDD:238465 19/82 (23%)

Return to query results.
Submit another query.