DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14077 and cox13

DIOPT Version :9

Sequence 1:NP_001246828.1 Gene:CG14077 / 40066 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_588417.1 Gene:cox13 / 2538807 PomBaseID:SPCC1739.09c Length:130 Species:Schizosaccharomyces pombe


Alignment Length:82 Identity:19/82 - (23%)
Similarity:36/82 - (43%) Gaps:10/82 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 QIVAQHSK----LWQKISLF--GVLPMIAILTLLVFSTRSEEERLEFKNYEHMYR----RTKRYW 206
            |...:|:|    .|:|::.:  |...::|.........:.:|.....::.:..|.    |.|:|.
pombe    44 QAEEEHAKRSSEFWKKVTYYIGGPALILASANAYYIYCKHQEHAKHVEDTDPGYSFENLRFKKYP 108

  Fly   207 FKDGNRTAFHNSHFNAL 223
            :.||::|.|.|...|.|
pombe   109 WGDGSKTLFWNDKVNHL 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 19/82 (23%)
cox13NP_588417.1 Cyt_c_Oxidase_VIa 42..130 CDD:238465 19/82 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11504
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.960

Return to query results.
Submit another query.