DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14077 and cox13

Sequence 1:NP_001246828.1 Gene:CG14077 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_588417.1 Gene:cox13 PomBaseID:SPCC1739.09c Length:130 Species:Schizosaccharomyces pombe

Alignment Length:82 Identity:19/83 (23%)
Similarity:36/83 (43%) Gaps:10/83 (12%)


  Fly   152 QIVAQHSK----LWQKISLF--GVLPMIAILTLLVFSTRSEEERLEFKNYEHMYR----RTKRYW 206
            |...:|:|    .|:|::.:  |...::|.........:.:|.....::.:..|.    |.|:|.
pombe    44 QAEEEHAKRSSEFWKKVTYYIGGPALILASANAYYIYCKHQEHAKHVEDTDPGYSFENLRFKKYP 108

  Fly   207 FKDGNRTAFHNSHFNAL 223
            :.||::|.|.|...|.|
pombe   109 WGDGSKTLFWNDKVNHL 125

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 19/83 (23%)
cox13NP_588417.1 Cyt_c_Oxidase_VIa 42..130 CDD:238465 19/83 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001314
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11504
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.970

Return to query results.
Submit another query.