DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14077 and Cox6a1

Sequence 1:NP_001246828.1 Gene:CG14077 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_036946.1 Gene:Cox6a1 RGDID:2384 Length:111 Species:Rattus norvegicus

Alignment Length:113 Identity:41/114 (36%)
Similarity:59/114 (52%) Gaps:17/114 (15%)


  Fly   121 LLGKSTRKQKKPLTAIQGGDLGCPGRTGKKPQIVAQHSKLWQKISLFGVLPMIAILTLLVF--ST 183
            |||::..:..:|:::      |..|..|.        :::|:.::.|..||.:.:..|.||  |.
  Rat    14 LLGRALPRVGRPMSS------GAHGEEGS--------ARIWKALTYFVALPGVGVSMLNVFLKSR 64

  Fly   184 RSEEERLEFKNYEHMYRRTKRYWFKDGNRTAFHNSHFNALPPAGYEDE 231
            ..|.||.||..|.|:..|||.:.:.|||.|.|||.|.|.| |.|||||
  Rat    65 HEEHERPEFVAYPHLRIRTKPFPWGDGNHTLFHNPHMNPL-PTGYEDE 111

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 32/85 (38%)
Cox6a1NP_036946.1 Cyt_c_Oxidase_VIa 24..109 CDD:238465 35/100 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2306286
eggNOG 1 0.900 E1_KOG3469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1591077at2759
OrthoFinder 1 1.000 FOG0001314
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11504
Phylome 1 0.910 0.909 Consistency score
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.