DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14077 and COX6AL

Sequence 1:NP_001246828.1 Gene:CG14077 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_725504.1 Gene:COX6AL FlyBaseID:FBgn0050093 Length:94 Species:Drosophila melanogaster

Alignment Length:87 Identity:37/88 (42%)
Similarity:50/88 (57%) Gaps:4/88 (5%)


  Fly   148 GKKPQIVAQHSKLWQKISLFGVLPMIAILTLLVFSTRSEEERLEFKNYEHMYRRTKRYWFKDGNR 212
            |..|   |..:.||::::....||.|.:.....|:.....||..|..||::.|||||:.:.||||
  Fly    10 GNMP---ANTAGLWKRVTFLLALPAIVLCAANAFTGHKHVEREPFAKYEYLRRRTKRFPWGDGNR 71

  Fly   213 TAFHNSHFNALPPAGYEDEVDE 234
            :.|||:..||| |.||||||.|
  Fly    72 SLFHNAEVNAL-PEGYEDEVAE 92

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 32/81 (40%)
COX6ALNP_725504.1 Cyt_c_Oxidase_VIa 14..87 CDD:238465 30/74 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131258946
eggNOG 1 0.900 E1_KOG3469
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1430
OrthoDB 1 1.010 D1591077at2759
OrthoFinder 1 1.000 FOG0001314
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11504
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.