DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14077 and cox-6A

DIOPT Version :9

Sequence 1:NP_001246828.1 Gene:CG14077 / 40066 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_498082.1 Gene:cox-6A / 175693 WormBaseID:WBGene00006519 Length:128 Species:Caenorhabditis elegans


Alignment Length:75 Identity:22/75 - (29%)
Similarity:34/75 - (45%) Gaps:3/75 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 SKLWQKISLFGVLPMIAILTLLVFSTRSE---EERLEFKNYEHMYRRTKRYWFKDGNRTAFHNSH 219
            |:.|:||.....:|.:|:.....|....:   .||.|...|..:..|.|.:.:.|||.:.|||..
 Worm    48 SETWKKIFFIASIPCLALTMYAAFKDHKKHMSHERPEHVEYAFLNVRNKPFPWSDGNHSLFHNKA 112

  Fly   220 FNALPPAGYE 229
            ...:|..|:|
 Worm   113 EQFVPGVGFE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 21/73 (29%)
cox-6ANP_498082.1 Cyt_c_Oxidase_VIa 38..122 CDD:238465 21/73 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166405
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1430
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1591077at2759
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11504
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.