DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14077 and cox-6A

Sequence 1:NP_001246828.1 Gene:CG14077 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_498082.1 Gene:cox-6A WormBaseID:WBGene00006519 Length:128 Species:Caenorhabditis elegans

Alignment Length:75 Identity:22/76 (29%)
Similarity:34/76 (45%) Gaps:3/76 (4%)


  Fly   158 SKLWQKISLFGVLPMIAILTLLVFSTRSE---EERLEFKNYEHMYRRTKRYWFKDGNRTAFHNSH 219
            |:.|:||.....:|.:|:.....|....:   .||.|...|..:..|.|.:.:.|||.:.|||..
 Worm    48 SETWKKIFFIASIPCLALTMYAAFKDHKKHMSHERPEHVEYAFLNVRNKPFPWSDGNHSLFHNKA 112

  Fly   220 FNALPPAGYE 229
            ...:|..|:|
 Worm   113 EQFVPGVGFE 122

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 21/74 (28%)
cox-6ANP_498082.1 Cyt_c_Oxidase_VIa 38..122 CDD:238465 21/74 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131258967
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1430
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1591077at2759
OrthoFinder 1 1.000 FOG0001314
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11504
Phylome 1 0.910 0.714 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.