DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14077 and COX6A2

Sequence 1:NP_001246828.1 Gene:CG14077 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_005196.1 Gene:COX6A2 HGNCID:2279 Length:97 Species:Homo sapiens

Alignment Length:104 Identity:38/105 (36%)
Similarity:50/105 (48%) Gaps:19/105 (18%)


  Fly   131 KPLT-----AIQGGDLGCPGRTGKKPQIVAQHSKLWQKISLFGVLPMIAILTLLVFSTRSEEERL 190
            :|||     |.:||..|...||             |:.::....||.:|:.|...:.......|.
Human     6 RPLTRGLASAAKGGHGGAGART-------------WRLLTFVLALPSVALCTFNSYLHSGHRPRP 57

  Fly   191 EFKNYEHMYRRTKRYWFKDGNRTAFHNSHFNALPPAGYE 229
            ||:.|:|:..|||.|.:.|||.|.|||||.|.| |.|||
Human    58 EFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPL-PTGYE 95

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 30/83 (36%)
COX6A2NP_005196.1 Cyt_c_Oxidase_VIa 26..95 CDD:238465 30/83 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2295203
eggNOG 1 0.900 E1_KOG3469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1591077at2759
OrthoFinder 1 1.000 FOG0001314
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11504
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.