DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14077 and Cox6a1

Sequence 1:NP_001246828.1 Gene:CG14077 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_031774.1 Gene:Cox6a1 MGIID:103099 Length:112 Species:Mus musculus

Alignment Length:112 Identity:39/113 (35%)
Similarity:57/113 (50%) Gaps:17/113 (15%)


  Fly   122 LGKSTRKQKKPLTAIQGGDLGCPGRTGKKPQIVAQHSKLWQKISLFGVLPMIAILTLLVF--STR 184
            ||::....::|:::      |..|..|.        :::|:.::.|..||.:.:..|.||  |..
Mouse    16 LGRALPGLRRPMSS------GAHGEEGS--------ARMWKALTYFVALPGVGVSMLNVFLKSRH 66

  Fly   185 SEEERLEFKNYEHMYRRTKRYWFKDGNRTAFHNSHFNALPPAGYEDE 231
            .|.||..|..|.|:..|||.:.:.|||.|.|||.|.|.| |.|||||
Mouse    67 EEHERPPFVAYPHLRIRTKPFPWGDGNHTLFHNPHVNPL-PTGYEDE 112

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 31/85 (36%)
Cox6a1NP_031774.1 Cyt_c_Oxidase_VIa 25..110 CDD:238465 34/100 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2306142
eggNOG 1 0.900 E1_KOG3469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1430
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001314
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11504
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.750

Return to query results.
Submit another query.