DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arx and Gtsf2

DIOPT Version :10

Sequence 1:NP_649071.1 Gene:arx / 40061 FlyBaseID:FBgn0036826 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001102758.1 Gene:Gtsf2 / 500938 RGDID:1563200 Length:154 Species:Rattus norvegicus


Alignment Length:163 Identity:35/163 - (21%)
Similarity:68/163 - (41%) Gaps:42/163 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CPYNKEHKMLRKKLQQHILKCRVIYKDTVELMV-CPFNSSHLIPEPQFFQHTQSCEDRNIIVHYQ 67
            |||:..|::...:||.|:..|:.......:.|. |.:|:.|::|..:..:|..:|.:|.      
  Rat     9 CPYDPNHRIPASRLQYHLASCKKKNPKIAKKMANCKYNACHVVPIKRLKEHEANCINRT------ 67

  Fly    68 TSAPAVLSEDTRHAKIESEENWDDDESVPDYDPQVYCSRANIVREPN-------GLFP------- 118
                ||..|.....|| ::.:::::|::        ||..:...:|:       ..||       
  Rat    68 ----AVDDEPLNLQKI-TQPSFEENENL--------CSAGSQFTDPDVWNVDHMNHFPSFVLETF 119

  Fly   119 AQRRAFIEQEKRRHFGEDYEE---EKKPRKAKA 148
            |.:....|.:.|     |.:|   :|.|..:|:
  Rat   120 APKTLVCESDSR-----DLQEAMSDKHPNSSKS 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arxNP_649071.1 zf-U11-48K 1..25 CDD:461603 7/20 (35%)
zf-U11-48K 34..58 CDD:461603 6/24 (25%)
Gtsf2NP_001102758.1 zf-U11-48K 9..29 CDD:461603 7/19 (37%)
zf-U11-48K 40..63 CDD:461603 6/22 (27%)

Return to query results.
Submit another query.