DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arx and gtsf-1

DIOPT Version :10

Sequence 1:NP_649071.1 Gene:arx / 40061 FlyBaseID:FBgn0036826 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_503000.1 Gene:gtsf-1 / 178471 WormBaseID:WBGene00020286 Length:169 Species:Caenorhabditis elegans


Alignment Length:105 Identity:28/105 - (26%)
Similarity:50/105 - (47%) Gaps:8/105 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VYCPYNKEHKMLRKKLQQHILKCRV----IYKDTVELMVCPFNSSHLIPEPQFFQHTQSCEDRNI 62
            :.||||.:||:..::...|:.|||.    .|..:::|..|.:|..|.:||.:...|...|:.::.
 Worm    19 ITCPYNSDHKVSMEEFNTHLWKCRTEKLHFYPHSLKLKRCSYNMRHFLPEEELQFHEIFCKRQSA 83

  Fly    63 IVHYQTSAPAV---LSEDTRHAKIESEENWDDDESVPDYD 99
            .:..|.|...:   ::|.....|:..|.. .|:||:...|
 Worm    84 DLRRQLSLEPLELNVAEHLAAQKLRKEYE-KDEESLDGSD 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arxNP_649071.1 zf-U11-48K 1..25 CDD:461603 8/22 (36%)
zf-U11-48K 34..58 CDD:461603 7/23 (30%)
gtsf-1NP_503000.1 zf-U11-48K 19..42 CDD:461603 8/22 (36%)
zf-U11-48K 55..79 CDD:461603 7/23 (30%)

Return to query results.
Submit another query.