DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3902 and ACX2

DIOPT Version :9

Sequence 1:NP_649069.2 Gene:CG3902 / 40059 FlyBaseID:FBgn0036824 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_201316.1 Gene:ACX2 / 836635 AraportID:AT5G65110 Length:692 Species:Arabidopsis thaliana


Alignment Length:443 Identity:101/443 - (22%)
Similarity:169/443 - (38%) Gaps:87/443 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SSATGLPPPLTFLTDD--EKMMKETVAKLAQEQIQPLVKKMDFEHKFDPSVVKAVFENGLMGIEI 87
            :|...|..|:....||  |..|.:.:..:.:..::|.....|...|:                  
plant    83 NSRPDLQTPIEISKDDHRELCMNQLIGLVREAGVRPFRYVADDPEKY------------------ 129

  Fly    88 DTELGGSGCNFMTNIVVVEELSKIDPAVAAFVDIHNTLVNSLMIKFGNAEQKAKYLPKLAQ-EYA 151
                          ..::|.:..:|.::...:.:..:|....:|..|..:.:.||...:.. :|.
plant   130 --------------FAIMEAVGSVDMSLGIKMGVQYSLWGGSVINLGTKKHRDKYFDGIDNLDYT 180

  Fly   152 GSFALTEPGAGSDAFSLKTVAKKD--GSHYVIN-----GSKMWISNSDVAGVF-LIFAN-AKPED 207
            |.||:||...||:...|:|.|..|  ...:||:     ..|.||.|:.|.|.| .:||. ..|..
plant   181 GCFAMTELHHGSNVQGLQTTATFDPLKDEFVIDTPNDGAIKWWIGNAAVHGKFATVFARLILPTH 245

  Fly   208 GYRGIT-----TFIV---DRET----PGLIVNKPEDKLGIRASGTCQLTFDNVRVPEENILGTFG 260
            ..:|::     .|||   |.:|    ||:.:.....|:|:.......|.|.:||:|.:|:|..||
plant   246 DSKGVSDMGVHAFIVPIRDMKTHQTLPGVEIQDCGHKVGLNGVDNGALRFRSVRIPRDNLLNRFG 310

  Fly   261 H--------------GYKYAA--GFLNEGRIGIAAQMVGLAQGTFDATIPYLLERKQFGD----- 304
            .              ..::.|  |.|..||:|:|...||:.:.:....|.|.|.|:|||.     
plant   311 DVSRDGTYTSSLPTINKRFGATLGELVGGRVGLAYASVGVLKISATIAIRYSLLRQQFGPPKQPE 375

  Fly   305 -AIYNFQSMQHQIATVATEIEAARLMT-YNAARLQEQGVPFQKE--------AAMAKYYASEVAQ 359
             :|.::||.||::..:.....|....| |...:..|......::        :|..|.|.:....
plant   376 VSILDYQSQQHKLMPMLASTYAYHFATVYLVEKYSEMKKTHDEQLVADVHALSAGLKSYVTSYTA 440

  Fly   360 RAAIKCVDWMGGVGFTRDFPQEKYYRDVKIGAIYEGTTNMQLSTIAKCIKKDY 412
            :|...|.:..||.|:...........|..|...:||...:.|..:|..:.|.|
plant   441 KALSVCREACGGHGYAAVNRFGSLRNDHDIFQTFEGDNTVLLQQVAADLLKRY 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3902NP_649069.2 CaiA 37..414 CDD:224871 98/431 (23%)
SCAD_SBCAD 39..410 CDD:173847 96/425 (23%)
ACX2NP_201316.1 PLN02636 4..692 CDD:215342 101/443 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.