DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3902 and MGC147631

Sequence 1:NP_649069.2 Gene:CG3902 FlyBaseID:FBgn0036824 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001072710.1 Gene:MGC147631 XenbaseID:XB-GENE-5814061 Length:422 Species:Xenopus tropicalis

Alignment Length:403 Identity:121/404 (30%)
Similarity:203/404 (50%) Gaps:10/404 (2%)


  Fly     7 KLPVRMLANAARQQSAAMSSATGLPPPLTFLTDDEKMMKETVAKLAQEQIQPLVKKMDFEHKFDP 71
            :||...:...|..||.       |....:..|.|...::||:.|:...:|.|.|.:.:...:|..
 Frog    18 RLPTGPIYQTAANQST-------LQAQNSLYTPDHIAIRETLRKIIDTEINPYVDQWEDAGQFPA 75

  Fly    72 SVVKAVFEN-GLMGIEIDTELGGSGCNFMTNIVVVEELSKID-PAVAAFVDIHNTLVNSLMIKFG 134
            ..|..:..| |::|:...||.||.|.:|..:|.:.|||..|. ..|...:.:.:.:....:.:||
 Frog    76 HKVFKILGNAGILGVNKPTEYGGLGLDFSYSIAIAEELGNIRCSGVPMAIGVQSDMATPALTRFG 140

  Fly   135 NAEQKAKYL-PKLAQEYAGSFALTEPGAGSDAFSLKTVAKKDGSHYVINGSKMWISNSDVAGVFL 198
            :.|.|.::| |.:|.:......::|.|||||..|:||.|.|.|..|:|||||||.:|...|....
 Frog   141 SDELKRQFLVPTIAGDVVTCLGVSEAGAGSDVASIKTTAVKKGDDYIINGSKMWTTNGCQADWMC 205

  Fly   199 IFANAKPEDGYRGITTFIVDRETPGLIVNKPEDKLGIRASGTCQLTFDNVRVPEENILGTFGHGY 263
            :.||......::..:...:..:|||:.|.|..:|:|:::|.|.|:.|::||||.:.::|..|.|:
 Frog   206 LLANTSAGPPHKNKSLICLPMKTPGVQVTKKIEKIGMKSSDTAQIFFEDVRVPSKYLIGEEGMGF 270

  Fly   264 KYAAGFLNEGRIGIAAQMVGLAQGTFDATIPYLLERKQFGDAIYNFQSMQHQIATVATEIEAARL 328
            .|......|.|:...|.::.........||.|..:||.|...:.:.|.:..::|.:|||:|..|.
 Frog   271 TYQMLQFQEERMWGVANVLTPMGNILQETIDYTSQRKVFNQPVLHNQVVHFRLAELATEVELLRS 335

  Fly   329 MTYNAARLQEQGVPFQKEAAMAKYYASEVAQRAAIKCVDWMGGVGFTRDFPQEKYYRDVKIGAIY 393
            :.|.:..:..:|....|.|:|||..|..:|:..:..|:.:.||:|||.:....::|||.::.:|.
 Frog   336 LLYRSVAMYVEGNDVTKLASMAKLKAGRLARELSDSCLQFWGGMGFTDEVLVSRFYRDSRLLSIG 400

  Fly   394 EGTTNMQLSTIAK 406
            .|...:.||.|.|
 Frog   401 AGADEVMLSIICK 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3902NP_649069.2 CaiA 37..414 CDD:224871 115/374 (31%)
SCAD_SBCAD 39..410 CDD:173847 114/372 (31%)
MGC147631NP_001072710.1 CaiA 41..422 CDD:224871 115/374 (31%)
ACAD 43..416 CDD:299127 114/372 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D589058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.