DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3902 and zc4h2

DIOPT Version :9

Sequence 1:NP_649069.2 Gene:CG3902 / 40059 FlyBaseID:FBgn0036824 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001016675.1 Gene:zc4h2 / 549429 XenbaseID:XB-GENE-941217 Length:224 Species:Xenopus tropicalis


Alignment Length:164 Identity:37/164 - (22%)
Similarity:57/164 - (34%) Gaps:54/164 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LTDDEKMMKETVAKLAQEQIQPLVKKMDFEHKFDPSVVKAVFENGLMGIEIDTELGGSGCNFMTN 101
            |..:|:.:||    ..||....|.:||  .|         |.|..|:..:|         |.|.|
 Frog    38 LESEERHLKE----YKQEMDLLLQEKM--AH---------VEELRLIHADI---------NVMEN 78

  Fly   102 IVVVEE--LSKIDPAVAAFVDIHNTL---VNSLMIKFG--------NAEQKAK--YLPKLAQEYA 151
            .:...|  |:|:..:.....:.:..|   |::|.:..|        ..|:|..  |..|...|:.
 Frog    79 TIKQSENDLNKLLESTRRLHEEYKPLKEHVDALRMTLGLQRLPDLCEEEEKLSLDYFEKQKAEWQ 143

  Fly   152 GSFALTEP----------GAGSDAFSLKTVAKKD 175
                 |||          .|.:.|..|:...|:|
 Frog   144 -----TEPQEPPIPESLAAAAAAAQQLQVARKQD 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3902NP_649069.2 CaiA 37..414 CDD:224871 37/164 (23%)
SCAD_SBCAD 39..410 CDD:173847 36/162 (22%)
zc4h2NP_001016675.1 zf-C4H2 13..221 CDD:370830 37/164 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000508
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.