DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3902 and acdh-6

DIOPT Version :10

Sequence 1:NP_649069.2 Gene:CG3902 / 40059 FlyBaseID:FBgn0036824 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_498885.1 Gene:acdh-6 / 182112 WormBaseID:WBGene00015335 Length:408 Species:Caenorhabditis elegans


Alignment Length:47 Identity:13/47 - (27%)
Similarity:20/47 - (42%) Gaps:15/47 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 IIANFIEH------------RQVLTVQYTVKNK--MFINMFVSIKWS 143
            :..|.|.|            |.|| ::.:..||  :|:.||.:.|.|
 Worm    18 LFINLITHSLYRLLRSLSRARSVL-IEISKHNKKRLFMMMFYTTKSS 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3902NP_649069.2 SCAD_SBCAD 39..410 CDD:173847 13/47 (28%)
acdh-6NP_498885.1 CaiA 25..396 CDD:441563 11/40 (28%)

Return to query results.
Submit another query.