DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dysb and dsbn-1

Sequence 1:NP_001262023.1 Gene:Dysb FlyBaseID:FBgn0036819 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_492628.1 Gene:dsbn-1 WormBaseID:WBGene00013697 Length:210 Species:Caenorhabditis elegans

Alignment Length:239 Identity:45/240 (19%)
Similarity:92/240 (38%) Gaps:55/240 (23%)


  Fly    38 SSQASGITTPISPLGLNESLSSSRSSSLSLSAPFQLTDGVPSHLNVAAGCSLLAKYEDDWQQIHG 102
            ||..:.::|.:..|.:|.|.:......:|       |:.|...||.:||..||..:::...::  
 Worm    12 SSVQAELSTGVEKLRMNVSANIVAQQKVS-------TESVNEILNTSAGNELLQNFQNLITEV-- 67

  Fly   103 ANEKNAEKAAQIAN----QISGIQDQASHQHRIMSELNSSLAGIPTLIAQLQNSSQVLNSLEEMG 163
              |:|..:..::||    ::...|.....:...:.|::..|........:::..:..::.|....
 Worm    68 --EENGAEGGRLANLCSTRMGRCQQMCKEKADAVMEIDEFLRNSVEFDKKIREINAQISKLTRFC 130

  Fly   164 KQLEIELEKLEDLREECELQEFILEQQFQLSRHKQKKLNELEQYRQQIAQKHQSKIKDQEQTLLK 228
            .|.|..:..||.|   ||:            .|.:.:::.:.|..:..|            |:::
 Worm   131 NQTEQAMTYLEAL---CEV------------AHTEGEVDLIRQQAKSAA------------TIVQ 168

  Fly   229 LQRERQAVFDDAFREDMEEYKQRGQLTKIQTTSNKLALEEVVLE 272
            ::.|..:|...|.|...|:             :.|...|||:||
 Worm   169 IECESPSVLTSALRSRPED-------------AVKAQQEEVMLE 199

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DysbNP_001262023.1 TMPIT 94..>189 CDD:285135 15/99 (15%)
dsbn-1NP_492628.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140904100
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.