DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atg3 and ATG3

Sequence 1:NP_649059.1 Gene:Atg3 FlyBaseID:FBgn0036813 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_014404.3 Gene:ATG3 SGDID:S000005290 Length:310 Species:Saccharomyces cerevisiae

Alignment Length:347 Identity:110/348 (32%)
Similarity:167/348 (48%) Gaps:72/348 (21%)


  Fly     8 VKGTALNVAEYLTPVLKESKFRETGVLTPEEFVAAGDHLVHHCPTWQW-AAGDETKTKPYLPKDK 71
            ::.|..:..|||||:..:|.|..||.:||||||.|||:|.|..|||:| ....:...:.:|||:|
Yeast     2 IRSTLSSWREYLTPITHKSTFLTTGQITPEEFVQAGDYLCHMFPTWKWNEESSDISYRDFLPKNK 66

  Fly    72 QFLITRNVPCYRRCKQ-MEYVGEETLVEEESGDGGWVETHQLNDDGTTQLEDKICELTMEETKEE 135
            ||||.|.|||.:|.:| :|..|.:.:::..:.||.               ||.:.|....||:..
Yeast    67 QFLIIRKVPCDKRAEQCVEVEGPDVIMKGFAEDGD---------------EDDVLEYIGSETEHV 116

  Fly   136 MHTPDSDKSAPGAGGQAEDEDDDEAIDMDDFEESGMLELVDPAVATTTRKPEPEAKASPVAAASG 200
            ..||        |||..:...||                :|..:.....|.|.|...:....|.|
Yeast   117 QSTP--------AGGTKDSSIDD----------------IDELIQDMEIKEEDENDDTEEFNAKG 157

  Fly   201 DAEASGDSVLHTRTYDLHISYDKYYQTPRLWVVGYDEQRKPLTVEQMYEDVSQDHAKKTVTMESH 265
               .....:...|.|||:|:|...|:.|::::||::....||:.|||:||:|.|:..||.|:|..
Yeast   158 ---GLAKDMAQERYYDLYIAYSTSYRVPKMYIVGFNSNGSPLSPEQMFEDISADYRTKTATIEKL 219

  Fly   266 PHLPGPNMA-SVHPCRHADIMKKIIQTVE----------------EGGG-----------QLGVH 302
            |......:: |:|||:||::||.::..|.                :|.|           .|.|.
Yeast   220 PFYKNSVLSVSIHPCKHANVMKILLDKVRVVRQRRRKELQEEQELDGVGDWEDLQDDIDDSLRVD 284

  Fly   303 LYLIIFLKFVQTVIPTIEYDFT 324
            .|||:||||:.:|.|:|::|:|
Yeast   285 QYLIVFLKFITSVTPSIQHDYT 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atg3NP_649059.1 Autophagy_N 8..135 CDD:281916 48/129 (37%)
Autophagy_act_C 219..280 CDD:281917 24/62 (39%)
Autophagy_C 301..325 CDD:287367 13/25 (52%)
ATG3NP_014404.3 Autophagy_N 2..141 CDD:309202 56/178 (31%)
Autophagy_act_C 173..235 CDD:309203 24/62 (39%)
Autophagy_C 283..307 CDD:313582 13/25 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C163201094
eggNOG 1 0.900 E1_KOG2981
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I1012
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004324
OrthoInspector 1 1.000 T1136729
orthoMCL 1 0.900 OOG5_128240
Panther 1 1.100 LDO PTHR12866
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R108
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.