DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atg3 and atg-3

Sequence 1:NP_649059.1 Gene:Atg3 FlyBaseID:FBgn0036813 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_500024.1 Gene:atg-3 WormBaseID:WBGene00021922 Length:305 Species:Caenorhabditis elegans

Alignment Length:338 Identity:170/339 (50%)
Similarity:214/339 (63%) Gaps:50/339 (15%)


  Fly     1 MQSVLNTVKGTALNVAEYLTPVLKESKFRETGVLTPEEFVAAGDHLVHHCPTWQWA-AGDETKTK 64
            ||:::|.:|..||.:.|..||||:||||||||||||||:||||||||||||||:|| |.|.:|.:
 Worm     1 MQNLVNNLKSAALQIGETFTPVLRESKFRETGVLTPEEYVAAGDHLVHHCPTWKWAGASDPSKIR 65

  Fly    65 PYLPKDKQFLITRNVPCYRRCKQMEYVGE-ETLVEEESG------DGGWVETHQLNDDGTTQLED 122
            .:||.||||||||||||::|||||||..: |.::.||.|      :.|||:||....        
 Worm    66 TFLPIDKQFLITRNVPCHKRCKQMEYDEKLEKIINEEDGEYQTSDETGWVDTHHYEK-------- 122

  Fly   123 KICELTMEETKEEMHTPDSDKSAPGAGGQAEDEDDDEAID-----MDDFEESGMLELVDPAVATT 182
               |....|.||:...|      |.|..:..|:||:|.:|     :||.||       ||.....
 Worm   123 ---EHEKNEEKEQSTAP------PPAAPEDSDDDDEEPLDLDELGLDDDEE-------DPNRFVV 171

  Fly   183 TRKPEPEAKASPVAAASGDAEASGDSVLHTRTYDLHISYDKYYQTPRLWVVGYDEQRKPLTVEQM 247
            .:||         .||..|.....:.|   |||||||.||||||.|||:::||||.|:||||||.
 Worm   172 EKKP---------LAAGNDNSGEVEKV---RTYDLHICYDKYYQVPRLFLMGYDENRRPLTVEQT 224

  Fly   248 YEDVSQDHAKKTVTMESHPHLPGPNMASVHPCRHADIMKKIIQTVEEGGGQLGVHLYLIIFLKFV 312
            |||.|.||:.||:|:|:||.: ...|.:||||:||::||::|....|.|..||||.||.:|||||
 Worm   225 YEDFSADHSNKTITVEAHPSV-DLTMPTVHPCKHAEMMKRLINQYAESGKVLGVHEYLFLFLKFV 288

  Fly   313 QTVIPTIEYDFTQ 325
            |.||||||||:|:
 Worm   289 QAVIPTIEYDYTR 301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atg3NP_649059.1 Autophagy_N 8..135 CDD:281916 75/135 (56%)
Autophagy_act_C 219..280 CDD:281917 38/61 (62%)
Autophagy_C 301..325 CDD:287367 19/24 (79%)
atg-3NP_500024.1 Autophagy_N 8..120 CDD:281916 71/112 (63%)
Autophagy_act_C 196..256 CDD:281917 38/61 (62%)
Autophagy_C 277..300 CDD:287367 18/23 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C162583756
eggNOG 1 0.900 E1_KOG2981
Hieranoid 1 1.000
Homologene 1 1.000 H6836
Inparanoid 1 1.050 311 1.000 Inparanoid score I1524
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1432328at2759
OrthoFinder 1 1.000 FOG0004324
OrthoInspector 1 1.000 T474254
orthoMCL 1 0.900 OOG5_128240
Panther 1 1.100 LDO PTHR12866
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R108
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.