DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atg3 and Atg3

Sequence 1:NP_649059.1 Gene:Atg3 FlyBaseID:FBgn0036813 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_599221.1 Gene:Atg3 RGDID:708464 Length:314 Species:Rattus norvegicus

Alignment Length:331 Identity:208/332 (63%)
Similarity:258/332 (78%) Gaps:19/332 (6%)


  Fly     1 MQSVLNTVKGTALNVAEYLTPVLKESKFRETGVLTPEEFVAAGDHLVHHCPTWQWAAGDETKTKP 65
            ||:|:|||||.||.||||||||||||||:||||:||||||||||||||||||||||.|:|.|.|.
  Rat     1 MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKA 65

  Fly    66 YLPKDKQFLITRNVPCYRRCKQMEYVGE-ETLVEEESGDGGWVETHQLNDDGTTQLEDKICELTM 129
            |||..||||:|:|||||:|||||||..| |.::||:.||||||:|:  ::.|.|.:.:.:.|:|:
  Rat    66 YLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTY--HNTGITGITEAVKEITL 128

  Fly   130 EETKEEMHTPDSDKSAPGAGGQAEDEDDDEAIDMDDFEESGMLELVDPAVATTTRKPEPEAKASP 194
             |:|:.:...|.....    .:.|:|::.||.||:::||||:|| .|.|...|.|         .
  Rat   129 -ESKDSIKLQDCSVLC----DEEEEEEEGEAADMEEYEESGLLE-TDEATLDTRR---------I 178

  Fly   195 VAAASGDAEASG-DSVLHTRTYDLHISYDKYYQTPRLWVVGYDEQRKPLTVEQMYEDVSQDHAKK 258
            |.|....|:|.| |::|.||||||:|:|||||||||||:.||||||:|||||.||||:||||.||
  Rat   179 VEACKAKADAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKK 243

  Fly   259 TVTMESHPHLPGPNMASVHPCRHADIMKKIIQTVEEGGGQLGVHLYLIIFLKFVQTVIPTIEYDF 323
            |||:|:|||||.|.|.||||||||::|||||:||.||||:||||:||:|||||||.||||||||:
  Rat   244 TVTIENHPHLPPPLMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDY 308

  Fly   324 TQNFNM 329
            |::|.|
  Rat   309 TRHFTM 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atg3NP_649059.1 Autophagy_N 8..135 CDD:281916 86/128 (67%)
Autophagy_act_C 219..280 CDD:281917 49/61 (80%)
Autophagy_C 301..325 CDD:287367 20/24 (83%)
Atg3NP_599221.1 Autophagy_N 8..133 CDD:281916 85/126 (67%)
Autophagy_act_C 204..265 CDD:281917 47/62 (76%)
Autophagy_C 286..309 CDD:287367 18/23 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C163189845
eggNOG 1 0.900 E1_KOG2981
Hieranoid 1 1.000
Homologene 1 1.000 H6836
Inparanoid 1 1.050 425 1.000 Inparanoid score I1682
OMA 1 1.010
OrthoDB 1 1.010 D1432328at2759
OrthoFinder 1 1.000 FOG0004324
OrthoInspector 1 1.000 T1088632
orthoMCL 1 0.900 OOG5_128240
Panther 1 1.100 LDO PTHR12866
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.