DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nufip and NUFIP

Sequence 1:NP_649058.1 Gene:Nufip FlyBaseID:FBgn0036812 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001078603.1 Gene:NUFIP AraportID:AT5G18440 Length:470 Species:Arabidopsis thaliana

Alignment Length:314 Identity:66/315 (21%)
Similarity:110/315 (35%) Gaps:91/315 (29%)


  Fly     6 LPKFVLPSP------------KFGKPNGSTTSNHL--YLTPSGMTLLPRSKQPPPMYGARGST-- 54
            ||:|.:|:.            :|...|.:...:.|  :..||   |.|.:....|...:..|.  
plant    86 LPQFAMPNHINQLLPNLLGNLQFAVANSNLMGHSLPNFFQPS---LEPHAFSSRPQLNSFNSLPY 147

  Fly    55 VPAKYLHQEQSSPVSVPASPPVYHSP-PRPEFCHTCVMELANSQDMKLHLEQHEFC--PADDCDF 116
            .|....||...|      .||.:..| |:.:..........|..|.:....:|:..  |......
plant   148 PPVPNPHQNHQS------GPPGFSEPRPQGQSVDNTNGSGPNGNDFRNKFPKHQNFKGPGQGFQR 206

  Fly   117 AALH---------------------NILERHIESNHITGTYVKVKK-----VWSEEELAAWRAER 155
            ..||                     |.::..::.:. ||...|.||     :::..|:..||..|
plant   207 PQLHQADNGKRKSGFNKDHRGKGNNNKMKTGLDGSD-TGNIAKEKKRSYALMYTPREVQQWREAR 270

  Fly   156 RKKFPT--------AANVELARLAKEQRIKRGERLE--ASKSRFG-------------NREDRQR 197
            ||.:||        ..||..:.|.:|.:::|.:..|  |.::..|             |.|....
plant   271 RKNYPTKFLVEKKVKKNVSASILDEEAKMRRQQLREVLAKQAELGVEVAEVPSHYLSNNDEQVNG 335

  Fly   198 TRGGPQGDHKVRF--DPKNKKKRCAKGKANEKKKKRVGTDKANEALKQKETNED 249
            .||...| .|.||  :.:||::...|.|.:.||.:          |:.|::::|
plant   336 DRGNNNG-RKGRFQNNRRNKRRHDRKDKFDNKKPR----------LEDKKSSQD 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NufipNP_649058.1 NUFIP1 126..180 CDD:287432 18/67 (27%)
NUFIPNP_001078603.1 NUFIP1 241..295 CDD:287432 16/55 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13309
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.