DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nufip and NUFIP

DIOPT Version :9

Sequence 1:NP_649058.1 Gene:Nufip / 40043 FlyBaseID:FBgn0036812 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001078603.1 Gene:NUFIP / 831962 AraportID:AT5G18440 Length:470 Species:Arabidopsis thaliana


Alignment Length:314 Identity:66/314 - (21%)
Similarity:110/314 - (35%) Gaps:91/314 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LPKFVLPSP------------KFGKPNGSTTSNHL--YLTPSGMTLLPRSKQPPPMYGARGST-- 54
            ||:|.:|:.            :|...|.:...:.|  :..||   |.|.:....|...:..|.  
plant    86 LPQFAMPNHINQLLPNLLGNLQFAVANSNLMGHSLPNFFQPS---LEPHAFSSRPQLNSFNSLPY 147

  Fly    55 VPAKYLHQEQSSPVSVPASPPVYHSP-PRPEFCHTCVMELANSQDMKLHLEQHEFC--PADDCDF 116
            .|....||...|      .||.:..| |:.:..........|..|.:....:|:..  |......
plant   148 PPVPNPHQNHQS------GPPGFSEPRPQGQSVDNTNGSGPNGNDFRNKFPKHQNFKGPGQGFQR 206

  Fly   117 AALH---------------------NILERHIESNHITGTYVKVKK-----VWSEEELAAWRAER 155
            ..||                     |.::..::.:. ||...|.||     :::..|:..||..|
plant   207 PQLHQADNGKRKSGFNKDHRGKGNNNKMKTGLDGSD-TGNIAKEKKRSYALMYTPREVQQWREAR 270

  Fly   156 RKKFPT--------AANVELARLAKEQRIKRGERLE--ASKSRFG-------------NREDRQR 197
            ||.:||        ..||..:.|.:|.:::|.:..|  |.::..|             |.|....
plant   271 RKNYPTKFLVEKKVKKNVSASILDEEAKMRRQQLREVLAKQAELGVEVAEVPSHYLSNNDEQVNG 335

  Fly   198 TRGGPQGDHKVRF--DPKNKKKRCAKGKANEKKKKRVGTDKANEALKQKETNED 249
            .||...| .|.||  :.:||::...|.|.:.||.:          |:.|::::|
plant   336 DRGNNNG-RKGRFQNNRRNKRRHDRKDKFDNKKPR----------LEDKKSSQD 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NufipNP_649058.1 NUFIP1 126..180 CDD:402194 18/66 (27%)
NUFIPNP_001078603.1 PABP-1234 <33..173 CDD:130689 21/95 (22%)
NUFIP1 241..295 CDD:402194 16/54 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13309
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.