DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nufip and nufip1

Sequence 1:NP_649058.1 Gene:Nufip FlyBaseID:FBgn0036812 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001039189.1 Gene:nufip1 XenbaseID:XB-GENE-1015991 Length:521 Species:Xenopus tropicalis

Alignment Length:508 Identity:133/509 (26%)
Similarity:196/509 (39%) Gaps:135/509 (27%)


  Fly    39 PRSKQPPPMYGARGSTVPAKYLHQEQSSPVSVPASPPVYHS------PPRPEFCHTCVMELANSQ 97
            |:.:|.|.....||.  ...|.:.|...|.....|....||      |....:|.||.....|..
 Frog    60 PQYRQQPSYSEQRGG--GHGYFNHESRMPFGNCQSRTKQHSKKQKKEPVYTYYCDTCDRGFKNQA 122

  Fly    98 DMKLHLEQHEFCPADDCDFAALHNILERHIESNHITGTYVKVKKVWSEEELAAWRAERRKKFPTA 162
            ....|..||..|....|.|:|...::..|.::.|..|  .|..|:.:.:|:|.||.||||.|||.
 Frog   123 KYNEHTSQHVKCEEPGCSFSAHEKLVHIHWKNMHAPG--AKRIKLDTPDEIAKWREERRKNFPTL 185

  Fly   163 ANVELARLAKEQRIKRGERLEASKSRFGNREDRQRTRGGPQGDHKVRFDPKNKKKRCAKGKANEK 227
            ||:...:..|::|.:|||.|  :..:||                        |.|...||::::.
 Frog   186 ANIVKKQQLKKEREERGEVL--TTPQFG------------------------KMKGMKKGQSSQP 224

  Fly   228 KKKRVGTDKANEALKQKETNEDKKEEEVNLCSLG--NAKFGGTGQMPEYQHFKAKVQKKDNALSS 290
            .:   ||.......||:...::.:|.| ||...|  ||:...|....|    |...||::|.:..
 Frog   225 NQ---GTKNWQSRKKQRNFKKNFRENE-NLHQDGTSNAEAEKTTDSQE----KNVAQKRNNTVDP 281

  Fly   291 FLGMYGSDSDEESEAESDDQNTADCSKQIPAQVESSQSMPSEITEMGPALEASNTPNS------- 348
            ...:.|||    .|:::|:...:.....:|.||.|:.|  ..|...|.:.::.:.|..       
 Frog   282 LNMLAGSD----PESDNDETKVSTGLSVVPKQVTSALS--KLICSYGSSSDSDSEPTEQPIRCVK 340

  Fly   349 ---VDNTQTCEDFTPMLEMT-SSDQVPREISNISQITTSNSEPAKEDGSSDEGPDEEPFQRVTET 409
               .:|.|..:...|....| .||:..:|:.  ||...| |:.|::    .:||..         
 Frog   341 AALEENKQILQTHKPSAAGTVLSDKPGKELK--SQHVYS-SDAAQQ----SKGPHS--------- 389

  Fly   410 ITASDPVKPPP----EPMEPKPQTAPKRAAPKRIYGLNYKRARKQTPNTMLSKLLESDIRHERNV 470
                   |.||    :..|.||...|.|..|                 |:|..||.:||||||||
 Frog   390 -------KVPPNKSHKKCEKKPFRTPIRCQP-----------------TLLEMLLANDIRHERNV 430

  Fly   471 LLQCVRHVCERNFFGIGQAKPNQETLVTTCDKTVD------------STPDAL 511
            :|||||::.:.:||                ||.||            ||.||:
 Frog   431 VLQCVRYILQNDFF----------------DKPVDIKCETGTAHGSVSTSDAV 467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NufipNP_649058.1 NUFIP1 126..180 CDD:287432 22/54 (41%)
nufip1NP_001039189.1 NUFIP1 150..203 CDD:287432 22/55 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332107655
eggNOG 1 0.900 E1_28HFB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1394860at2759
OrthoFinder 1 1.000 FOG0006055
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.