DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nufip and Nufip1

Sequence 1:NP_649058.1 Gene:Nufip FlyBaseID:FBgn0036812 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001007759.1 Gene:Nufip1 RGDID:1359440 Length:486 Species:Rattus norvegicus

Alignment Length:506 Identity:128/507 (25%)
Similarity:190/507 (37%) Gaps:175/507 (35%)


  Fly    19 PNGSTTSNHLYLTPSGMTLLPRSKQPPPMYGARGSTVPAKY----LHQEQSSPVSVPASPPVYHS 79
            |||..|.|..:.:|:..:..|:|.              |.|    |.|.:... ......||:|.
  Rat   118 PNGFPTYNTSFHSPATHSYFPQSY--------------ANYNDFNLPQNRKQK-KKKRKEPVFHF 167

  Fly    80 PPRPEFCHTCVMELANSQDMKLHLEQHEFCPADDCDFAALHNILERHIESNHITGTYVKVKKVWS 144
                 ||.||.....|.:...:|:.:|:.||..||.|:|...|::.|..:.|..|  :|..|:.:
  Rat   168 -----FCDTCDRGFKNQEKYDIHMSEHKKCPEVDCSFSAHEKIVQFHWRNMHAPG--MKKIKLDT 225

  Fly   145 EEELAAWRAERRKKFPTAANVELARLAKEQRIKRGERLEASKSRFGNREDRQRTRGGPQGDH--- 206
            .|::|.||.||||.:||.||:|..:|.:.::.||||.|  :.:::|..:...|        |   
  Rat   226 PEDIARWREERRKNYPTLANIERKKLLQLEKEKRGEVL--TTTQYGKMKGMSR--------HSQM 280

  Fly   207 -KVRFDPKNKKKRCAKGKANEKKKKRVGTDKANEALKQKETNEDKKEE---EVNLCSLGNAKFGG 267
             |:|...|:.|.:  .|.|.::....:|    |.|       .|.|.|   :||:..||..    
  Rat   281 AKIRSPGKHYKWK--SGGARQRAVLGLG----NRA-------RDLKPEIPTKVNVDPLGVL---- 328

  Fly   268 TGQMPEYQHFKAKVQKKDNALSSFLGMYGSDSDEESEAESDDQNTADCSKQIPAQVESSQSMPSE 332
                                         ..||.||:.:...|...               :|.|
  Rat   329 -----------------------------IHSDSESDKDEKSQRAI---------------VPKE 349

  Fly   333 ITEMGPALEASNTPNSVDNTQTCEDFTPMLEMTSSDQVPREISNISQITTSNSEPAKEDGSSDEG 397
            :|   |||              |       .:.||      ..|:|             ||..| 
  Rat   350 VT---PAL--------------C-------SLMSS------YGNVS-------------GSESE- 370

  Fly   398 PDEEPFQRVTETITASDPVKPPPEPMEPKPQTAPKRAAPKRIYGLNYKRAR--------KQ---- 450
            |:|.|.:...| :.|.:.|.|...|..|:...   |...:.:....:|..|        ||    
  Rat   371 PEEAPIKTEAE-VLAENRVLPSSPPKSPRHNV---RTTARTVLRAKWKAQRSGLRKITLKQKKSP 431

  Fly   451 -----TPNT----MLSKLLESDIRHERNVLLQCVRHVCERNFFGI--GQAK 490
                 .|.|    :|..||..||||||||:|||||::.:::|||:  |..|
  Rat   432 CHPLFEPRTRHPHLLEMLLAPDIRHERNVILQCVRYIIKKDFFGLTAGSVK 482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NufipNP_649058.1 NUFIP1 126..180 CDD:287432 22/54 (41%)
Nufip1NP_001007759.1 NUFIP1 209..261 CDD:287432 22/54 (41%)
Bipartite nuclear localization signal. {ECO:0000250} 236..252 9/16 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332113175
eggNOG 1 0.900 E1_28HFB
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I4978
OMA 1 1.010
OrthoDB 1 1.010 D1394860at2759
OrthoFinder 1 1.000 FOG0006055
OrthoInspector 1 1.000 T1088631
orthoMCL 1 0.900 OOG5_132996
Panther 1 1.100 LDO PTHR13309
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.