DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nufip and nufip1

Sequence 1:NP_649058.1 Gene:Nufip FlyBaseID:FBgn0036812 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001108358.1 Gene:nufip1 ZFINID:ZDB-GENE-030131-6203 Length:406 Species:Danio rerio

Alignment Length:443 Identity:110/444 (25%)
Similarity:162/444 (36%) Gaps:139/444 (31%)


  Fly    80 PPRPEFCHTCVMELANSQDMKLHLEQHEFCPADDCDFAALHNILERHIESNHITGTYVKVKKVWS 144
            |....||.:|..........:.|:.||..|...||.|:|...:::.|..:||..|  .|..|:.:
Zfish    81 PEFSHFCDSCDRGFKTQDKYEEHIAQHVKCSVPDCQFSAHEKLVKIHWRNNHTAG--AKRIKLET 143

  Fly   145 EEELAAWRAERRKKFPTAANVELARLAKEQRIKRGERLEASKSRFGNREDRQRTRGGPQGDHKVR 209
            ||::..||.|||:.:||..|||..:...|.:.:||:.||.  .:||    |.|.|||||      
Zfish   144 EEDIRRWREERRRNYPTLRNVEKKQKLMEVKEQRGDVLET--PQFG----RFRGRGGPQ------ 196

  Fly   210 FDPKNKKKRCAKGKANEKKKKRVGTDKANEALKQKETNEDKKEEEVNLCSLGNAKFGGTGQMPEY 274
                       :|:.:...|::........||...|.:.||.|     |               .
Zfish   197 -----------RGRGSSLGKRQHEDRDPLAALADSEADSDKDE-----C---------------V 230

  Fly   275 QHFKAKVQKKDNALSSFLGMYGSDSDEESEAESDDQNTADCSKQIPAQVESSQSMPSEITEMGPA 339
            |......:....||.|.:..||..|.||   |.||                           .|.
Zfish   231 QKITVAPRSVTAALGSLMSSYGEQSSEE---EEDD---------------------------APL 265

  Fly   340 LEASNTPNSVDNTQTCEDFTPMLEMTSSDQVPREISNISQITT---SNSEPAKEDGSSDEGPDEE 401
            |:|:                         ||.:|  |.|.:||   :::.|              
Zfish   266 LKAA-------------------------QVLQE--NQSILTTPQHTHTAP-------------- 289

  Fly   402 PFQRVTETITASDPVKPPPEPMEPKPQTAPKRAAPKRIYGLNYKRAR------------KQTPNT 454
              ||.....||:......|...:   .|||:....:|..|...:..|            ::.|.|
Zfish   290 --QRTHTAPTATQHTHTSPTATQ---HTAPQSHHAQRHRGRGRRGGRGGRGAHNKLAEPQRQPPT 349

  Fly   455 MLSKLLESDIRHERNVLLQCVRHVCERNFFGIGQAKPNQETLVTTCDKTVDST 507
            :|..||..||||||||:|||||.:....|||:.....|:   ::.|::.:..:
Zfish   350 LLEMLLAPDIRHERNVVLQCVRFIIRNRFFGLAGKDVNE---ISVCEEPISQS 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NufipNP_649058.1 NUFIP1 126..180 CDD:287432 21/54 (39%)
nufip1NP_001108358.1 NUFIP1 126..179 CDD:287432 21/55 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332112377
eggNOG 1 0.900 E1_28HFB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1394860at2759
OrthoFinder 1 1.000 FOG0006055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132996
Panther 1 1.100 LDO PTHR13309
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.