DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nufip and Nufip1

Sequence 1:NP_649058.1 Gene:Nufip FlyBaseID:FBgn0036812 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_038773.1 Gene:Nufip1 MGIID:1351474 Length:484 Species:Mus musculus

Alignment Length:485 Identity:122/486 (25%)
Similarity:192/486 (40%) Gaps:145/486 (30%)


  Fly    19 PNGSTTSNHLYLTPSGMTLLPRSKQPPPMYGARGSTVPAKYLHQEQSSPVSVPASPPVYHSPPRP 83
            |||.:|.:..|.:|...:..|||..             ||:...:.....:.....||:|.    
Mouse   118 PNGFSTYHTSYQSPVTHSYFPRSHD-------------AKFNLPQNRKQKTKKRKEPVFHF---- 165

  Fly    84 EFCHTCVMELANSQDMKLHLEQHEFCPADDCDFAALHNILERHIESNHITGTYVKVKKVWSEEEL 148
             ||.||.....|.:....|:.:|..||..||.|:|...|::.|..:.|..|  :|..|:.:.||:
Mouse   166 -FCDTCDRGFKNQEKYDTHMSEHTKCPEVDCSFSAHEKIVQFHWRNMHAPG--MKKIKLDTPEEI 227

  Fly   149 AAWRAERRKKFPTAANVELARLAKEQRIKRGERLEASKSRFGNREDRQRTRGGPQGDH----KVR 209
            |.||.||||.:||.||:|..:..:.::.||||.|  :.:::|..:...|        |    |:|
Mouse   228 ARWREERRKNYPTLANIERKKKLQLEKAKRGEVL--TTTQYGKMKGMSR--------HSQMAKIR 282

  Fly   210 FDPKNKKKRCAKGKANEKKKKRVGTDKANEALKQKETNEDKKEEEVNLCSLGNAKFGGTGQMPEY 274
            ...|:.|.|  :|.|.::.                            :..|||.......::|. 
Mouse   283 SPGKHHKWR--RGGARQRA----------------------------VVGLGNHARDSKPEVPS- 316

  Fly   275 QHFKAKVQKKDNALSSFLGMYGSDSDEESEAESDDQNTADCSKQIPAQVESSQSMPSEITEMGPA 339
               ||.|    :.|.:.:     .||.||:.|...|.|.               :|.|:|   ||
Mouse   317 ---KANV----DPLGALI-----HSDSESDKEEKAQRTV---------------VPKEVT---PA 351

  Fly   340 LEASNTPNSVDNTQTCEDFTPMLEMTSSDQVPREISNISQITTSNSEPAKEDGSSDEGPDEEPFQ 404
            |              |.                .:|:...::.|:|||       :|.|.:...:
Mouse   352 L--------------CS----------------LMSSYGDVSGSDSEP-------EEAPIKTEAE 379

  Fly   405 RVTET-ITASDPVKPPPEPMEPKPQTAPKRAAPKRIYGL---NYKRARKQ-----TPNT----ML 456
            .:.|. :..|.|.|.|.:.::...:|..:.....:..||   :.||.:..     .|.|    :|
Mouse   380 VLAENHVLHSSPPKSPKQNVQTTGRTVSRSKWENQRNGLRKISLKRKKSHCHPLFEPRTHHPYLL 444

  Fly   457 SKLLESDIRHERNVLLQCVRHVCERNFFGI 486
            ..||..||||||||:|||||::.:::|||:
Mouse   445 EMLLAPDIRHERNVILQCVRYIIKKDFFGL 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NufipNP_649058.1 NUFIP1 126..180 CDD:287432 22/54 (41%)
Nufip1NP_038773.1 NUFIP1 207..259 CDD:287432 22/54 (41%)
Bipartite nuclear localization signal 234..250 8/16 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332109677
eggNOG 1 0.900 E1_28HFB
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S8311
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006055
OrthoInspector 1 1.000 T1085082
orthoMCL 1 0.900 OOG5_132996
Panther 1 1.100 LDO PTHR13309
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5687
TreeFam 1 0.960
1211.690

Return to query results.
Submit another query.