DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nufip and NUFIP1

Sequence 1:NP_649058.1 Gene:Nufip FlyBaseID:FBgn0036812 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_036477.2 Gene:NUFIP1 HGNCID:8057 Length:495 Species:Homo sapiens

Alignment Length:499 Identity:129/500 (26%)
Similarity:191/500 (38%) Gaps:140/500 (28%)


  Fly    12 PSPKFGKPNGSTTSNHLYLTPSGMTLLPRSKQPPPMYGARGSTVPAKYLHQEQSSPVSVPAS--- 73
            |.|. |:|.....|...|...|........|...|  ..:.|..|.||  ..:.:..|:|.|   
Human   103 PQPS-GQPWNFHASTSWYWRQSSDRFPRHQKSFNP--AVKNSYYPRKY--DAKFTDFSLPPSRKQ 162

  Fly    74 ------PPVYHSPPRPEFCHTCVMELANSQDMKLHLEQHEFCPADDCDFAALHNILERHIESNHI 132
                  .||:|.     ||.||.....|.:....|:.:|..||..||.|.|...|::.|..:.|.
Human   163 KKKKRKEPVFHF-----FCDTCDRGFKNQEKYDKHMSEHTKCPELDCSFTAHEKIVQFHWRNMHA 222

  Fly   133 TGTYVKVKKVWSEEELAAWRAERRKKFPTAANVELARLAKEQRIKRGERL---EASKSRFGNRED 194
            .|  :|..|:.:.||:|.||.||||.:||.||:|..:..|.::.|||..|   :..|.:..:|..
Human   223 PG--MKKIKLDTPEEIARWREERRKNYPTLANIERKKKLKLEKEKRGAVLTTTQYGKMKGMSRHS 285

  Fly   195 RQRTRGGPQGDHKVRFDPKNKKKRCAKGKANEK-KKKRVGTDKANE----ALKQKETNEDKKEEE 254
            :......|..:||.:.|  |.::|...|..:.. ..|..|..:||.    .|...::..||:|: 
Human   286 QMAKIRSPGKNHKWKND--NSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEK- 347

  Fly   255 VNLCSLGNAKFGGTGQMPEYQHFKAKVQKKDNALSSFLGMYGSDSDEESEAESDDQNTADCSKQI 319
                             |::.....:|..   ||.|.:..|||.|..|||.|           :.
Human   348 -----------------PQHSVIPKEVTP---ALCSLMSSYGSLSGSESEPE-----------ET 381

  Fly   320 PAQVESSQSMPSEITEMGPALEASNTPNSVDNTQTCEDFTPMLEMTSSDQVPREISNISQITTSN 384
            |.:.|:.....:::.:       |:.|.|                 .|..|...:.|.|:..:.|
Human   382 PIKTEADVLAENQVLD-------SSAPKS-----------------PSQDVKATVRNFSEAKSEN 422

  Fly   385 SEPAKEDGSSDEGPDEEPFQRVTETITASDPVKPPPEPMEPKPQTAPKRAAPKRIYGLNYKRARK 449
            .:.:.|                                     :|.|||   |:.|. ||     
Human   423 RKKSFE-------------------------------------KTNPKR---KKDYH-NY----- 441

  Fly   450 QT---PNT----MLSKLLESDIRHERNVLLQCVRHVCERNFFGI 486
            ||   |.|    :|..||..||||||||:|||||::.:::|||:
Human   442 QTLFEPRTHHPYLLEMLLAPDIRHERNVILQCVRYIIKKDFFGL 485

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NufipNP_649058.1 NUFIP1 126..180 CDD:287432 23/54 (43%)
NUFIP1NP_036477.2 NUFIP1 216..>253 CDD:287432 18/39 (46%)
Bipartite nuclear localization signal 243..260 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332111232
eggNOG 1 0.900 E1_28HFB
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I4851
Isobase 1 0.950 0 Normalized mean entropy S8311
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1394860at2759
OrthoFinder 1 1.000 FOG0006055
OrthoInspector 1 1.000 T1074977
orthoMCL 1 0.900 OOG5_132996
Panther 1 1.100 LDO PTHR13309
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5687
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.