DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nufip and SPBC16C6.03c

Sequence 1:NP_649058.1 Gene:Nufip FlyBaseID:FBgn0036812 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_596801.3 Gene:SPBC16C6.03c PomBaseID:SPBC16C6.03c Length:207 Species:Schizosaccharomyces pombe

Alignment Length:136 Identity:32/137 (23%)
Similarity:52/137 (38%) Gaps:35/137 (26%)


  Fly   109 CPADDCDFAALHNILERHIESNHITGTYVKVKKVWSEEELAAWRAERRKKFPTAANVELARLAKE 173
            |..|..::....||                  .:.:.||:.||..||:|.:||.:|:.    :|:
pombe    84 CAVDGIEYLKRRNI------------------SINTPEEIEAWIQERKKNWPTESNIR----SKQ 126

  Fly   174 QRIKRGERLEASKSRFGNREDRQRTRGGPQGDHKVRFDPKNKKKRCAKGKANEKKKKRVGTDKAN 238
            ::.|..|.|.|:.:  ....|.|.|   |........:|..|:        ...|||.:.|...|
pombe   127 EKEKVMENLGAADT--SQSIDAQPT---PSQHPLAHHEPHEKR--------GPPKKKSLYTKLLN 178

  Fly   239 EALKQK 244
            ..|:|:
pombe   179 TQLEQE 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NufipNP_649058.1 NUFIP1 126..180 CDD:287432 12/54 (22%)
SPBC16C6.03cNP_596801.3 NUFIP1 <96..130 CDD:287432 13/56 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13309
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.