DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Slc25a14

DIOPT Version :8

Sequence 1:NP_649053.2 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_006257593.1 Gene:Slc25a14 / 85263 RGDID:621433 Length:344 Species:Rattus norvegicus

Alignment Length:258 Identity:64/259 (25%)
Similarity:116/259 (45%) Gaps:44/259 (17%)


  Fly     6 KDRGMASNLQQAIRTHGFISLYDGLSAQLLRQLTYTSMRFHLYEMGK----EHLDDPAGLLDKVL 66
            |.|||...|.:..|..|.::||.|::..||||.:|.:::..:|:..|    |.|:|.. ||..::
  Rat   102 KYRGMFHALFRIYREEGILALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDET-LLINMI 165

  Fly    67 VAALAGCVAGVVGTPMELINTRMQVNRALPKETRWNYRNVFDG-----LYRVTREEGFTKLYSGC 126
            ...::|.::..:..|.:::..|||...:|           |.|     ...:.::||...|:.|.
  Rat   166 CGVVSGVISSTIANPTDVLKIRMQAQGSL-----------FQGSMIGSFIDIYQQEGTRGLWRGV 219

  Fly   127 FLSFMRSSLITISQNAAYDQAKQIYAEFFH-----MKHDNTLLHLISSVTAAFVCGPIIKPIENL 186
            ..:..|::::...:...||..|:      |     |..|..|.|.:||.|..........|::.:
  Rat   220 VPTAQRAAIVVGVELPVYDITKK------HLIVSGMLGDTILTHFVSSFTCGLAGALASNPVDVV 278

  Fly   187 RYLRMVDSRRLI----------NSISYMMRF-GSRGPFRGMVPYVLRMVPNTVITFLSFEQLR 238
            | .||::.|.::          :.|..|.:. |....::|..|..||:.|..:|.|:::|||:
  Rat   279 R-TRMMNQRAIVGHVDLYKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLK 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6893NP_649053.2 Mito_carr <5..55 CDD:278578 18/53 (34%)
Mito_carr 57..151 CDD:278578 19/99 (19%)
Slc25a14XP_006257593.1 Mito_carr 59..155 CDD:278578 18/53 (34%)
PTZ00169 63..342 CDD:240302 64/259 (25%)
Mito_carr 156..245 CDD:278578 20/107 (19%)
Mito_carr 253..342 CDD:278578 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.