DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: not and USP4

Sequence 1:NP_001287106.1 Gene:not FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_003354.2 Gene:USP4 HGNCID:12627 Length:963 Species:Homo sapiens

Alignment Length:639 Identity:119/640 (19%)
Similarity:184/640 (29%) Gaps:310/640 (48%)


  Fly   156 GLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDC--------GSKSSHKCLVCEV-SRLFQ 211
            ||.||.|||.|||||..:|.|.:|..|:|||:.|.::.        |.|..    :.|. :.|.:
Human   300 GLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGE----IAEAYAELIK 360

  Fly   212 EFYSGSRSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHR--HCVKAKAEHESKSNSS 274
            :.:||..:.::.......:...|...:||:|||:.|.....||.||.  :.||.|...|.| :::
Human   361 QMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELK-DAN 424

  Fly   275 GSGSGTNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISL--------- 330
            |......:..:..:|.....:.|:| .|.|:.:|.:||..|..||.|:|||..::|         
Human   425 GRPDAVVAKEAWENHRLRNDSVIVD-TFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRV 488

  Fly   331 ----------------------------------------------------------------- 330
                                                                             
Human   489 MEVFLVPADPHCRPTQYRVTVPLMGAVSDLCEALSRLSGIAAENMVVADVYNHRFHKIFQMDEGL 553

  Fly   331 ----------------------------------------------------------------- 330
                                                                             
Human   554 NHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLES 618

  Fly   331 ----------------------------------------------------------------- 330
                                                                             
Human   619 LYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGED 683

  Fly   331 ----DLGETT---THGGVTPKTLI----------------------------------------- 347
                |..|||   ..|...||.|.                                         
Human   684 EPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRR 748

  Fly   348 -------------------------------DCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFS 381
                                           ||:|.:|..|.||......|..||.:|::||:|.
Human   749 LYYDEQESEAYEKHVSMLQPQKKKKTTVALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFD 813

  Fly   382 LRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVE-FDMTPF---MSEKKNAYGDFRFSLYAVVNH 442
            |.:||.::..|||||.::.....|:.:.::||:. .:|:.|   :|.:...|     .|.||.||
Human   814 LWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPIRGLNMSEFVCNLSARPYVY-----DLIAVSNH 873

  Fly   443 VGTIDTGHYTAYVRHQ-KDTWVKCDDHVITMASLKQVLDSEGYLLFYHKNVLEY 495
            .|.:..||||||.::: ...|...||..:::||..|::....|:|||.:...|:
Human   874 YGAMGVGHYTAYAKNKLNGKWYYFDDSNVSLASEDQIVTKAAYVLFYQRRDDEF 927

Known Domains:


GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 116/630 (18%)
USP4NP_003354.2 Necessary for interaction with SART3. {ECO:0000269|PubMed:20595234} 27..216
Peptidase_C19 35..923 CDD:321984 118/634 (19%)
Nuclear export signal. {ECO:0000250|UniProtKB:P35123} 133..141
Required for USP4 activation by providing conformational flexibility between the DUSP and catalytic domains. {ECO:0000269|PubMed:25404403} 229..295
Regulates ubiquitin dissociation. {ECO:0000269|PubMed:25404403} 384..386 0/2 (0%)
Necessary for interaction with RBL2. {ECO:0000250|UniProtKB:P35123} 405..407 2/2 (100%)
Necessary for interaction with RB1 and RBL2. {ECO:0000250|UniProtKB:P35123, ECO:0000269|PubMed:11571652} 459..463 2/4 (50%)
Interacts with DUSP and ubiquitin-like 1 domains and is required for USP4 activation. {ECO:0000269|PubMed:25404403} 485..775 8/290 (3%)
Nuclear localization signal. {ECO:0000250|UniProtKB:P35123} 767..772 0/5 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1591
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.