DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: not and usp4

Sequence 1:NP_001287106.1 Gene:not FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_002662556.2 Gene:usp4 ZFINID:ZDB-GENE-041008-187 Length:1009 Species:Danio rerio

Alignment Length:678 Identity:114/679 (17%)
Similarity:185/679 (27%) Gaps:357/679 (53%)


  Fly   156 GLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGSKSSHKCLVCEVSR------------ 208
            ||.||.|||.|||||..:|.|.:||.|::||:.||::           .|::|            
Zfish   317 GLCGLSNLGNTCFMNSALQCLSNTPPLTEYFLEDRYE-----------AEINRENPLGMRGEIAE 370

  Fly   209 ----LFQEFYSGSRSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAE-HE 268
                |.::.:....|.::.......:...|...:||:|||:.|.....||.||....:.|.: :.
Zfish   371 AYADLVKQMWLSRSSYVAPRTFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYL 435

  Fly   269 SKSNSSGSGSGTNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDL- 332
            :..::.|......:..:.::|.....:.|:| ||.|:.:|.:||..|:.||.|:|||..::|.| 
Zfish   436 ALRDAEGRPDEIVAKEAWANHRLRNDSIIVD-IFHGLFKSTLVCPECSKVSVTFDPFCYLTLPLP 499

  Fly   333 ----------------------------------------------------------------- 332
                                                                             
Zfish   500 MKKDRTMEVYLVRTDPQFRAMQFRVVVPKMGAVADLCSALAKLSGVPSENMVVADVYNHRFHKIY 564

  Fly   333 ----------------------------------------------------------------- 332
                                                                             
Zfish   565 KRDDGLNQIMEKDDIFVYEVLEEDSERMNLPVYFRERHAKHSGGSSGTMLFGQPLLITVPRLNLT 629

  Fly   333 ----------------------------------------------------------------- 332
                                                                             
Zfish   630 VDTLYERVLERIGRYVKRSQGTITESRASASATSSSSSQSPECLASVSSHGTGLSGCSSPVSDGA 694

  Fly   333 ----------------------------------------------GE----------------- 334
                                                          ||                 
Zfish   695 SCSAGSNGSNHSGTCNGPNGVCDGDEEAMDHQESPEPENSHSDTVDGEEDSEPENGPNSSGGKSF 759

  Fly   335 -------------------------------TTTHGGV--------------------------- 341
                                           .|||..|                           
Zfish   760 NSRPKLFSFSMVNSYGTANISSLPFDGNLLKLTTHSTVAIDWDSDTKRLCYDDQEAEAYDKHESM 824

  Fly   342 -------TPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHS 399
                   |...|.:|:|.:|..|.||......|.|||.:|::||:|.|.:||.::..|||||.::
Zfish   825 LHAQKKKTTVALRECIELFTTMETLGEHDPWYCPTCKKHQQATKKFDLWSLPRILVVHLKRFSYN 889

  Fly   400 ALIDRKISSFIQFPV-EFDMTPFMSEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQKD-TW 462
            .....|:.:.:.||: :.:|:.|:.:.|  ...:.:.|.||.||.|.:..||||||.:::.| .|
Zfish   890 RCWRDKLDTVVDFPIRDLNMSEFVCDPK--ADPYIYDLIAVSNHYGGMGGGHYTAYGKNKADGKW 952

  Fly   463 VKCDDHVITMASLKQVLDSEGYLLFYHK 490
            ...||..::.|:..|::....|:|||.:
Zfish   953 YYFDDSSVSAATEDQIVTKAAYVLFYQR 980

Known Domains:


GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 112/674 (17%)
usp4XP_002662556.2 UBP12 8..981 CDD:227847 114/679 (17%)
DUSP 44..141 CDD:197831
Ubiquitin_3 155..242 CDD:291502
Peptidase_C19 319..>507 CDD:271592 54/200 (27%)
USP7_C2 526..>606 CDD:291217 0/80 (0%)
Peptidase_C19R <834..979 CDD:239139 51/147 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1591
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.