DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: not and usp3

Sequence 1:NP_001287106.1 Gene:not FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_012821863.1 Gene:usp3 XenbaseID:XB-GENE-962759 Length:522 Species:Xenopus tropicalis

Alignment Length:487 Identity:149/488 (31%)
Similarity:233/488 (48%) Gaps:62/488 (13%)


  Fly    44 CNCFECGSYGIQLYACLHCIYFGCRGAHITSHLRSKK-------HNVALELSHGTLYCYACRDFI 101
            |:...||.| :..:|..|   :....|.:..|.|.:|       |.|.::.|..:.|||.|.||:
 Frog    44 CSSVHCGRY-VNGHAKKH---YEDAQAPLNCHKRQEKTDKDRMQHTVCMDCSSYSTYCYRCDDFV 104

  Fly   102 YDARSREYALINRKLE-AKDLQKSIGWVPWVPTTKETN-----LLLANARRRLVRPN-QTIGL-- 157
              ....:..|:.:..| .::|:.|       ..|.|.:     |..|:..::|::.| .|..|  
 Frog   105 --VNDTKLCLVQKVREHLQNLENS-------AFTAERHRKRKFLESASLSKKLLKVNGSTTALCA 160

  Fly   158 RGLLNLGATCFMNCIVQALVHTPLLSDYF-------MSDRHDCGSKSSHK--------CLVCEVS 207
            .||.|||.|||||.|:|:|.:......||       :.:....|.::.|.        .||.|..
 Frog   161 TGLRNLGNTCFMNAILQSLSNIQQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDVNVSLVEEFR 225

  Fly   208 RLFQEFYSGSRSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSN 272
            :.....:.|:::..|...|.:::|....:..||:|||||||....||.||   ::.:.|.:..|:
 Frog   226 KTLCALWQGNQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLH---LELQGEFDGSSH 287

  Fly   273 SSGSGSGTNSSNSSSSH-CYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGE-- 334
            |..|.:  |.|.|:|:. |....:.::..:|.|:||::|.|..|...|..:|||.|:|||:..  
 Frog   288 SVLSQA--NCSRSASNKCCINGASTVVTSVFGGVLQNEVNCLICGTESRKFDPFLDLSLDIPSQF 350

  Fly   335 -----TTTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLK 394
                 .....|.| .||.|||..:|..|.|.......|..||..|:|||:|.::.||.|:..|||
 Frog   351 RNKRCKNQENGPT-CTLRDCLRSFTDLEELDETELYTCLKCKKKQKSTKKFWIQKLPKVLCLHLK 414

  Fly   395 RFEHSALIDRKISSFIQFPVE-FDMTPFMSEKKNAYGD-FRFSLYAVVNHVGT-IDTGHYTAYVR 456
            ||..:|.:..|:.:::.||:. .||..|:.|.:|...: ..:.|.|||.|.|: :.:||||||..
 Frog   415 RFHWTAYLRNKVDTYVDFPLRGLDMKSFLLEPENIGPESCLYDLAAVVVHHGSGVGSGHYTAYAT 479

  Fly   457 HQKDTWVKCDDHVITMASLKQVLDSEGYLLFY 488
            | |..|...:|..:|:...:.|..::.|:|||
 Frog   480 H-KGRWFHFNDSTVTLTEEETVAKAKAYILFY 510

Known Domains:


GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999 18/64 (28%)
Peptidase_C19D 158..489 CDD:239125 118/358 (33%)
usp3XP_012821863.1 zf-UBP 29..107 CDD:280334 19/69 (28%)
UCH 160..510 CDD:278850 117/357 (33%)
Peptidase_C19 162..511 CDD:271592 118/357 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1867
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D929408at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.