DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: not and Usp8

Sequence 1:NP_001287106.1 Gene:not FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_650948.2 Gene:Usp8 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster

Alignment Length:347 Identity:106/348 (30%)
Similarity:177/348 (51%) Gaps:35/348 (10%)


  Fly   156 GLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGSKSSHKC---LVCEVSRLFQEFYSGS 217
            ||.||.|||.||:||.|:|.|.:||.|::|.:||::......|:|.   ::.||:.|.:|.::|.
  Fly   561 GLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKNYISRSNKTNGQVIEEVAALIKELWNGQ 625

  Fly   218 RSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGSGTNS 282
            ...::...|.:::..:.|...|.:|||:|||....:|.||..........:.:..|:...:....
  Fly   626 YKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILMDWLHSDLQTLHVPRQREMISASEKAWLEF 690

  Fly   283 SNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPKT-- 345
            :.:..|        :|..:|.|.::|.|.|.||:..|.||:.|.::||:|         .|.:  
  Fly   691 TKAKES--------MILHLFYGQMKSTVKCVACHKESATYESFSNLSLEL---------PPNSNV 738

  Fly   346 --LIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRF----EHSALIDR 404
              |..|::.|...|.:..   ..|.:||:.:::.|:..:..||.|:..|||||    .:|....:
  Fly   739 CQLNQCMDMYFSGERIHG---WNCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSGSYMK 800

  Fly   405 KISSFIQFPVE-FDMTPFMSE-KKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQK-DTWVKCD 466
            | .::::||:| .||.|:::. :..|.....:.||||.||.||::.|||||:.:... ..|.|.|
  Fly   801 K-QNYLRFPLENLDMNPYIARAESRAVTPKTYQLYAVSNHYGTMEGGHYTAFCKSANYGKWFKFD 864

  Fly   467 DHVITMASLKQVLDSEGYLLFY 488
            |.|::......|:.|..|:|||
  Fly   865 DQVVSALDSSNVVSSAAYILFY 886

Known Domains:


GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 104/346 (30%)
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 104/345 (30%)
Peptidase_C19R 564..887 CDD:239139 104/345 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C127929409
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21646
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1591
33.060

Return to query results.
Submit another query.