DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: not and Usp39

Sequence 1:NP_001287106.1 Gene:not FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_573334.1 Gene:Usp39 FlyBaseID:FBgn0030969 Length:494 Species:Drosophila melanogaster

Alignment Length:476 Identity:105/477 (22%)
Similarity:178/477 (37%) Gaps:89/477 (19%)


  Fly    54 IQLYACLHC-IYFGCRG--AHITSHLRSKKHNVALELSHGTLYCYACRDFIYDARSREYA-LINR 114
            |.:||||.| .||..||  .|..:|...:.|:|.|.|.....||......|.|:...:.. ::|.
  Fly    64 INVYACLVCGKYFQGRGTNTHAYTHSVGEAHHVFLNLHTLRFYCLPDNYEIIDSSLDDIKYVLNP 128

  Fly   115 KLEAKDLQKSIGWVPWVPTTKETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQALVHT 179
            ....:::.|.....|....|.:..|.|.             |:.||.|:.|..:.|.::.||.|.
  Fly   129 TFTRQEISKLDQLQPKHSRTVDGVLYLP-------------GVVGLNNIKANDYCNVVLHALSHV 180

  Fly   180 PLLSDYFMSDRHDCGSKSSHK-----------CLVCEVSRLFQEFYS--GSRSPLSLHRLLH--L 229
            ..|.|||:       .|.|:.           .||.....|.::.::  ..:|.:|.|.:|.  :
  Fly   181 GPLRDYFL-------QKQSYAHVVRPPGDSVFTLVQRFGELMRKMWNPRNFKSHVSPHEMLQAVV 238

  Fly   230 IWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGSGTNSSNSSSSHCYGQC 294
            :|: :|.....||.|..:|....|:.|||                 :..|....|||        
  Fly   239 LWS-SKRFQITEQGDPIDFLSWFLNTLHR-----------------ALKGNKHPNSS-------- 277

  Fly   295 NCIIDQIFTGML----------QSDVVCQACNGVSTTYDP------FWDISLDLGETTTHGGVTP 343
              |:.:||.|.:          :.|...:|....:..|..      |..::.||...........
  Fly   278 --ILYKIFLGEMKIYTRKMPPVELDDAAKAQLLATEEYKDQVEDKNFIYLTCDLPPPPLFTDEFR 340

  Fly   344 KTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDRKISS 408
            :.:|..:..|.........|:.:..|.|:  ...|:|.:..||..:..::|||..:.....|..:
  Fly   341 ENIIPQVNLYQLLSKFNGTAEKEYKTYKA--NFMKRFEITRLPQFIILYIKRFTKNTFFLEKNPT 403

  Fly   409 FIQFP---VEFDMTPFMSEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQKD-TWVKCDDHV 469
            .:.||   |:|.....|.::.....|.:::|.|.:.|.|....|.|.|::.|:.: .|.:..|..
  Fly   404 IVNFPIKHVDFGDILGMRQRDKDVKDTKYNLVANIVHDGDPKKGTYRAHILHKANGQWYEMQDLH 468

  Fly   470 ITMASLKQVLDSEGYLLFYHK 490
            :|....:.:..:|.|:..|.:
  Fly   469 VTEILPQMITLTESYIQIYER 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999 19/52 (37%)
Peptidase_C19D 158..489 CDD:239125 78/366 (21%)
Usp39NP_573334.1 Peptidase_C19M 39..488 CDD:239134 105/474 (22%)
UCH 158..487 CDD:278850 77/366 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21646
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.