DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: not and usp-50

Sequence 1:NP_001287106.1 Gene:not FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_507513.2 Gene:usp-50 WormBaseID:WBGene00008441 Length:811 Species:Caenorhabditis elegans

Alignment Length:367 Identity:101/368 (27%)
Similarity:160/368 (43%) Gaps:64/368 (17%)


  Fly   156 GLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGSKSSHKCLVCEV---SRLFQEFYSGS 217
            |..||.|:|.||||:..:|.|..||.|::.|           :.|..|.:|   |||      ||
 Worm   476 GAVGLFNMGNTCFMSATLQCLFQTPGLAEVF-----------TKKVFVSKVNTQSRL------GS 523

  Fly   218 RSPLS--LHRLLHLIWNHA------------------KHLAGYEQQDAHEFFIATLDVLHRHCVK 262
            :..:|  ...|..:|||..                  :.|:...|.||.||.|..||.||....:
 Worm   524 KGVISAGFASLSDMIWNGTFTAIRPSRFLQLFSDTVYQPLSDGRQHDASEFQIFLLDALHEDTNQ 588

  Fly   263 AKAEHESKSNSSGSGSGTNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWD 327
            |:.....::...|:|....:::....| |......::::...:..|::.|..|...|.|::....
 Worm   589 AQRISFEQNYHGGAGIAKEAADFLKKH-YQFSLSPVNRLLGSITVSEIRCLTCGASSATFEENTI 652

  Fly   328 ISLDLGETTTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFH 392
            ||:::...::      .:|..||..:.....|...::..|..||..:.||:...|...|.|:..|
 Worm   653 ISVEIPSNSS------CSLDMCLRSHFSQTKLDGDSRWNCPKCKEPRASTRTSKLWQPPPVMIIH 711

  Fly   393 LKRFEHSALID---RKISSFIQF-PVEFDMTPFMSE----KKNAYGDFRFSLYAVVNHVGTIDTG 449
            ||||   ||.:   .|.::.:.| ...||:.|::.|    :|..|     .|||...|.|.:::|
 Worm   712 LKRF---ALFNGDFEKNTAAVTFETARFDVRPYLHEMAPAEKPVY-----KLYAATLHNGRLNSG 768

  Fly   450 HYTAYVRH-QKDTWVKCDDHVITMASLKQVLDSEGYLLFYHK 490
            ||||...| :.|.|::.||.|:|.....:|..|..|:|||.:
 Worm   769 HYTAVASHLRSDKWLRFDDSVVTPCENFKVDPSLAYILFYKR 810

Known Domains:


GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 100/363 (28%)
usp-50NP_507513.2 USP8_dimer 8..114 CDD:286108
UCH 477..808 CDD:278850 99/363 (27%)
Peptidase_C19R 479..809 CDD:239139 100/362 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1591
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.