DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: not and F07A11.4

Sequence 1:NP_001287106.1 Gene:not FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001254304.1 Gene:F07A11.4 WormBaseID:WBGene00008547 Length:1095 Species:Caenorhabditis elegans

Alignment Length:655 Identity:110/656 (17%)
Similarity:175/656 (27%) Gaps:330/656 (50%)


  Fly   156 GLRGLLNLGATCFMNCIVQALVHTPLLSDYFM--------SDRHDCGSKSSHKCLVCEVSRLFQE 212
            |..||.|:|.|||||.::|.||:...|.:||:        ::.:..||:.       .:::.|.:
 Worm   421 GYTGLRNIGNTCFMNAVLQMLVNNIELREYFLRNHYQPEINETNPLGSEG-------RLAKAFAD 478

  Fly   213 F----YSGSRSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNS 273
            |    :||.:..:...::.:::...|...|.:.|.|||||....||.||....:.|.:..:.:..
 Worm   479 FMHQMWSGHQKAIEPTQIKNIVAEKASQFANFAQHDAHEFLSFLLDGLHEDVNRVKKKPLTGTVE 543

  Fly   274 SGSGSGTNSSNSS-SSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDP------------- 324
            |......:.||.: .:|.....:..:| :|.|.|:|.|.|..|:.||.|:||             
 Worm   544 SHGRHDLDVSNEAWKNHILRNDSIFVD-LFHGQLKSHVQCPNCDRVSITFDPFVYLPVPFPKNKQ 607

  Fly   325 -----FWDI---------------------------------------------------SLDL- 332
                 ||.:                                                   |||: 
 Worm   608 STDLIFWPLENQTKPYKLTVSYSTEGTVADFLSVVSETVRVPTRNLRACEAICHKFDKIYSLDMK 672

  Fly   333 ----------------------------------------------------------------- 332
                                                                             
 Worm   673 VSDIVSPDRLFVFQTHDEMEFNEEIVILHVLQRELYRKNTKHACHECGNSKLKLKACEECYDAVY 737

  Fly   333 -----------------------------------------------------------GETTTH 338
                                                                       ||:::.
 Worm   738 CSKECQVANWSTGGHREECSKRKPSETVGHPLIVSLPRSQLTYQHLYRVLEAKSRHTPPGESSSS 802

  Fly   339 GGVT-----------PKT----------------------------------------------- 345
            ..|:           |:|                                               
 Worm   803 SSVSSTPRRRSVAAEPRTKNQKMFEIRKLSGQNDSFGSHSISDDEACQSLESGGYVSVNWINQRN 867

  Fly   346 ------------------------------------------LIDCLERYTRAEHLGSAAKIKCS 368
                                                      |...|:.::..|.|.......||
 Worm   868 GKPYITIENRKDIDVDVEKSRQMNSRNMNGYVKSNNSETNPHLTQMLDLFSETERLKPEESWYCS 932

  Fly   369 TCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDR-------KISSFIQFPVE-FDMTPFMSEK 425
            |||...|:||:..|..||.|:...||||.::|...:       |.:..:::|:| .||:||::|.
 Worm   933 TCKENVEATKKLQLYRLPPVLIIQLKRFVYTAFTYQSSMARRSKDTRSVEYPLESLDMSPFLAET 997

  Fly   426 KNAYGDFRFSLYAVVNHVGTIDTGHYTAYVR-------HQKDTWVKCDDHVITMASLKQVLDSEG 483
            ........:.|..||.|.|....|||.:..|       ..|..|...||..:...|...:...:.
 Worm   998 SPHPNSTMYDLTGVVCHSGNSYFGHYISMGRLADFDSSKTKIEWRNFDDSTVARQSTSTLQTEDA 1062

  Fly   484 YLLFY 488
            |||||
 Worm  1063 YLLFY 1067

Known Domains:


GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 109/654 (17%)
F07A11.4NP_001254304.1 Peptidase_C19 424..>608 CDD:271592 51/192 (27%)
USP7_C2 632..>709 CDD:291217 3/77 (4%)
zf-MYND 716..756 CDD:280009 0/40 (0%)
Peptidase_C19 <914..1068 CDD:271592 47/155 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1591
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.