DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: not and usp49

Sequence 1:NP_001287106.1 Gene:not FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_002933022.1 Gene:usp49 XenbaseID:XB-GENE-976521 Length:686 Species:Xenopus tropicalis

Alignment Length:677 Identity:159/678 (23%)
Similarity:235/678 (35%) Gaps:232/678 (34%)


  Fly     6 CRHY--QSYVKEHSYDTFRVIDAYFAACVNRDARERKAIHCNCFECGSYGIQLYACLHCIYFGCR 68
            |:|.  ....::||     :::.....||:.|.:|                .::|||.|.:..| 
 Frog     4 CKHVGRLRLAQDHS-----ILNPQKWRCVDCDTKE----------------SVWACLKCSHVAC- 46

  Fly    69 GAHITS----HLRSKKHNVALELSHGTLYCYACRDFI--------------------------YD 103
            |.:|..    |.:...|.:.:|:....::||.|:|::                          |.
 Frog    47 GRYIEEHSLRHFQESSHPLVMEVHELYVFCYLCQDYVLNDNPEGDLKLLRSALSAVWTQKQEAYS 111

  Fly   104 AR-------SREYALINRKLEAKDLQKSIGWVP-----------W-------------------- 130
            .|       |||.|..:|..:.:.|..:..|..           |                    
 Frog   112 RRSLRSQVTSREGAGCHRTSQGQPLMLTALWHRRQALLAKALRLWFERSSRGQLKLEEKRQRVEL 176

  Fly   131 ------------------------VPTTKETNLL-----------------------LANARRRL 148
                                    .|..|...||                       ...||||.
 Frog   177 ERRKEEARLRRQEVKRRLLEELANTPPRKSARLLSHAHTDSLIPQKFRDITASSPASQREARRRF 241

  Fly   149 -----VRPNQTIGLRGLLNLGATCFMNCIVQALVHTPLLSDYFM----SDR-------------- 190
                 :||..|.|:.||.|||.||:||.|:|.|.|.....:.|:    |::              
 Frog   242 NQLYSIRPTVTPGVTGLRNLGNTCYMNSILQVLSHLQKFRECFLTLDPSEKEELLARTGTNGKRR 306

  Fly   191 -------HDCGS---------------------KSSHKCLVCEVSRLFQEFYSGSRSPLSLHRLL 227
                   |..|.                     .:.|..|..|:..||:..:||..:.:|...:|
 Frog   307 VGDAGGGHPVGGIGLNGGSSITKSLELIQPKEPSTKHLSLCHELHTLFRVMWSGKWALVSPFAML 371

  Fly   228 HLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGSGTNSSNSSSSHCYG 292
            |.:|:......||:||||.||....||         |.:.|.:|..|........|....:.   
 Frog   372 HSVWSLIPAFRGYDQQDAQEFLCELLD---------KVQQELESEGSKRRILIPISQRKLTK--- 424

  Fly   293 QCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGET--TTHGGVTPKTLIDC-----L 350
            |...:::.||.|.|.|.|.|..|:..|.|.:||||:||:..|.  :...|:.|.|..:|     |
 Frog   425 QVLKVVNTIFHGQLLSQVTCLKCSYKSDTVEPFWDLSLEFPERYHSQEKGIAPVTTTECTLTEML 489

  Fly   351 ERYTRAEHLGSAAKIKCSTCKS-----------YQESTKQFSLRTLPSVVSFHLKRFEHSALIDR 404
            .::|..|.| ......|..|.|           ..|:.||..:..||.|:..|||||..|....|
 Frog   490 AKFTETEAL-EGRIYACDQCNSKRRKSSPKPLVLSEAKKQLMIFRLPQVLRLHLKRFRWSGRNHR 553

  Fly   405 -KISSFIQFPVEFDMTPFM-----SEKKNAYGDFRFSLYAVVNHVGT-IDTGHYTAYVRH-QKDT 461
             ||...:.|....:|.|:.     .....||   .:.|.|||.|.|. ..:||||||..: :...
 Frog   554 EKIGVHVFFDQVLNMEPYCRSVLPPSNPEAY---LYDLSAVVMHHGKGFGSGHYTAYCYNTEGGF 615

  Fly   462 WVKCDDHVITMASLKQVLDSEGYLLFY 488
            ||.|:|..:.|.|:::|..::.|:|||
 Frog   616 WVHCNDSKLNMCSVEEVCRTQAYILFY 642

Known Domains:


GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999 15/87 (17%)
Peptidase_C19D 158..489 CDD:239125 115/404 (28%)
usp49XP_002933022.1 zf-UBP 26..87 CDD:280334 18/78 (23%)
RILP-like 164..>201 CDD:304877 0/37 (0%)
UCH 255..642 CDD:278850 114/403 (28%)
Peptidase_C19 257..643 CDD:271592 115/403 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1867
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.