DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstC-R1 and MCHR2

Sequence 1:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001035269.1 Gene:MCHR2 HGNCID:20867 Length:340 Species:Homo sapiens

Alignment Length:372 Identity:111/373 (30%)
Similarity:176/373 (47%) Gaps:64/373 (17%)


  Fly    24 NATNWYNTNESLYTTELNHRWISGSSTIQPEESLYGTDLPTYQHCIATRNSFADLFTVVL---YG 85
            :|:.| ||:..|    ||..|        .:|..|.|            .|..|  ||:|   .|
Human     5 HASCW-NTSAEL----LNKSW--------NKEFAYQT------------ASVVD--TVILPSMIG 42

  Fly    86 FVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPFLLYT-MRICSWRFGEFMC 149
            .:|..||.||.|:::.::| |:.:||.:|||.||||||...::|:|||::. .|...|.||..:|
Human    43 IICSTGLVGNILIVFTIIR-SRKKTVPDIYICNLAVADLVHIVGMPFLIHQWARGGEWVFGGPLC 106

  Fly   150 KAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPVILY 214
            .......:...|..|..:.:||.|||.|:..|....|:||.:....::...|:.|.:|.|||.:|
Human   107 TIITSLDTCNQFACSAIMTVMSVDRYFALVQPFRLTRWRTRYKTIRINLGLWAASFILALPVWVY 171

  Fly   215 ASTVEQEDGINYSCNIMWPDAYKKHSGTTFILYTFFLGFAT---PLCFILSFYYLVI-------- 268
            :..::.:||:. ||      |:...|....:.||.:|...|   ||..||..|.|::        
Human   172 SKVIKFKDGVE-SC------AFDLTSPDDVLWYTLYLTITTFFFPLPLILVCYILILCYTWEMYQ 229

  Fly   269 --RKLRSVGPKPGTKSKEKRRAHRKVTRLVLTVISVYILCWLPHWISQVALIHSNPAQRDLSRLE 331
              :..|...|     |..|:|. .|:|::||.::.|:||...|:.:.|:..:     |.:...|.
Human   230 QNKDARCCNP-----SVPKQRV-MKLTKMVLVLVVVFILSAAPYHVIQLVNL-----QMEQPTLA 283

  Fly   332 ILI-FLLLGALVYSNSAVNPILYAFLSENFRKSFFKAFTCMNKQDIN 377
            ..: :.|...|.|::|::||.||..||.||:|...:......:::||
Human   284 FYVGYYLSICLSYASSSINPFLYILLSGNFQKRLPQIQRRATEKEIN 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 92/295 (31%)
7tm_1 94..353 CDD:278431 83/274 (30%)
MCHR2NP_001035269.1 7tmA_MCHR2 35..317 CDD:320461 95/301 (32%)
TM helix 1 36..62 CDD:320461 9/27 (33%)
TM helix 2 68..94 CDD:320461 13/26 (50%)
TM helix 3 106..136 CDD:320461 9/30 (30%)
TM helix 4 148..168 CDD:320461 5/20 (25%)
TM helix 5 194..223 CDD:320461 10/29 (34%)
TM helix 6 244..274 CDD:320461 10/31 (32%)
TM helix 7 285..310 CDD:320461 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.