DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstC-R1 and si:ch211-184m13.4

Sequence 1:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001122272.1 Gene:si:ch211-184m13.4 ZFINID:ZDB-GENE-070912-160 Length:343 Species:Danio rerio

Alignment Length:338 Identity:83/339 (24%)
Similarity:160/339 (47%) Gaps:36/339 (11%)


  Fly    50 TIQPEESLYGTDLPTYQHC-IATRNSFADLFTVVLYGFVCIIGLFGNTLVIYVVLRFSKMQTVTN 113
            |:...:::...|..:.|.| :......|.:...:.|..:.:|.:.||:||:.:..:..:....|.
Zfish     5 TVLDSQTMAENDSRSNQTCDVFIYKESARILFPLFYCLIFVISVAGNSLVLCITCQKRQKMNSTT 69

  Fly   114 IYILNLAVADECFLIGIP-FLLYTMRICSWRFGEFMCKAYMVSTSITSFTSSIFLLIMSADRYIA 177
            ||::|||::|..|.:.:| .:.|.:|...|.||:|:|:...:.....::.|..|:..:|.|||:|
Zfish    70 IYLINLAISDALFTLALPGRITYYIRGFDWPFGDFLCRLTAMIFYSNTYVSIAFMTCISVDRYLA 134

  Fly   178 VCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPV--ILYASTVEQEDG-------INYSCNIMWP 233
            :.|.....|.|...:.|.|..:.|   .|::|..  :|:.|.:|...|       .|:....|  
Zfish   135 MLHRQRCQRLRKTKVVKAVCVLVW---VVVLLETSPLLFKSIMENRPGHRTCMEFSNFDSKRM-- 194

  Fly   234 DAYKKHSGTTFILYTFFLGFATPLCFILSFYYLVIRKL-RSVGPKPGTKSKEKRRAHRKVTRLVL 297
             ||       .:|:...:||..||..||..|..|..|| ::....|.|   .|...|.:...::|
Zfish   195 -AY-------VLLFACVIGFFMPLGLILCSYSRVSCKLYKTAKENPLT---NKSGGHTRAKNMIL 248

  Fly   298 TVISVYILCWLPHWIS----QVALIHSNPAQRDLSRLEILIFLLLGALVYSNSAVNPILYAFLSE 358
            .::..:::|:.|:.|:    .|..::..|:..:|..|::.:.:.: |::..||.::||:|.|...
Zfish   249 LILLSFVVCFSPYHINIMQFVVRRLYHEPSCEELKALKLSLQVTV-AMMNLNSCLDPIIYFFAIR 312

  Fly   359 NFRK---SFFKAF 368
            .:::   |.||::
Zfish   313 TYKQRVMSLFKSY 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 77/298 (26%)
7tm_1 94..353 CDD:278431 71/274 (26%)
si:ch211-184m13.4NP_001122272.1 PHA03087 23..336 CDD:222976 80/321 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.