DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstC-R1 and si:dkey-42l23.2

Sequence 1:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_005173460.1 Gene:si:dkey-42l23.2 ZFINID:ZDB-GENE-131121-582 Length:343 Species:Danio rerio

Alignment Length:381 Identity:95/382 (25%)
Similarity:163/382 (43%) Gaps:65/382 (17%)


  Fly    77 DLFTVVLYGFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPFLLYTM---R 138
            ::|.:.:...:..:|:.||.|||||. .:....||.:|:.||||:||..|::.:...::|:   |
Zfish    20 EIFNICITTVIFAVGIIGNALVIYVT-GYKMKTTVNSIWFLNLAIADFIFILFLILTIFTLINKR 83

  Fly   139 ICSWRFGEFMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWST 203
            :  |.||:||||.....:.:..|.|...|..:|.||.::....:.:...|||...:::.|..|..
Zfish    84 V--WYFGDFMCKLASFVSVLNMFASIFLLTAISLDRCMSTWWIVWAQNKRTLFKGRIICAFVWVL 146

  Fly   204 SAVLMLPVILYASTVEQEDGINYSCNIMWPDAYKKHSGTTFIL-YTFFLGFATPLCFILSFYYLV 267
            |....:|.::..|      |.|.:|.      |...:...|:. |.|.:||..|...|.|.|..:
Zfish   147 SICCSIPFVICRS------GENKTCK------YNPGTNINFLFTYRFIVGFLIPFLVIASSYIAI 199

  Fly   268 IRKLRSVGPKPGTKSKEKRRAHR-KVTRLVLTVISVYILCWLPHWISQV--ALIHSNPAQRDLSR 329
                       |.::|..:|..: |..|::|:||..:.:||||..:.|:  |:.........:.:
Zfish   200 -----------GVRAKRLKRGKKLKPFRVILSVILAFFICWLPFHLQQLITAMTKGKDEWSGIRK 253

  Fly   330 LEILIFLLLGALVYSNSAVNPILYAFLSENFRKSFFKAFTCMNKQDINAQLQLEPSVFTKQGSKK 394
            :...|...:|:|.|.||.:|||||.|:.|.|:|..        ||.:...|:   :.|.:.    
Zfish   254 VLYNIGPFVGSLAYFNSCLNPILYVFMCEEFKKKL--------KQSLLLVLE---TAFAED---- 303

  Fly   395 RGGSKRLLTSNPQIPPLLPLNAGNNNSSTTTSSTTTAEKTGTTGTQKSCNSNGKVT 450
                             ||.....:..|..:.|....:....|.:..:.:.:.|.|
Zfish   304 -----------------LPFRTRQSTCSAFSESQGLQQPNDATFSSSASSQDNKTT 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 83/287 (29%)
7tm_1 94..353 CDD:278431 77/266 (29%)
si:dkey-42l23.2XP_005173460.1 7tm_1 37..277 CDD:278431 77/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24229
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.