DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstC-R1 and Gpr183

Sequence 1:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001102856.1 Gene:Gpr183 RGDID:1598095 Length:357 Species:Rattus norvegicus

Alignment Length:363 Identity:86/364 (24%)
Similarity:160/364 (44%) Gaps:30/364 (8%)


  Fly    53 PEESLYGTDLPTYQHCIATRNSFADLFTVVLYGFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYIL 117
            |..:.:|.:...|.|     :|.|.:...:.|..|.||||.||.|.:.|:::..|....|.:|.:
  Rat     8 PLAASHGNNCDLYAH-----HSTARILMPLHYSLVFIIGLVGNLLALVVIVQNRKKINSTTLYSM 67

  Fly   118 NLAVADECFLIGIPF-LLYTMRICSWRFGEFMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHP 181
            ||.::|..|...:|. ::|......||.|:.:|:...:...|.::....|:..:|.||:.||.||
  Rat    68 NLVISDILFTTALPTRIVYYALGFDWRIGDALCRITALLFYINTYAGVNFMTCLSIDRFFAVVHP 132

  Fly   182 ISSPRYRTLHIAKVVSAIAWSTSAVLMLPVILYASTVEQEDGINYSCNIMWPDAYKKHSGTT--- 243
            :...:.:.:..||.:....|.......||::|...:.::.|  ..:|.     .|....||.   
  Rat   133 LRYNKIKRIEYAKGICVFVWILVFAQTLPLLLKPMSKQEAD--KTTCM-----EYPNFEGTASLP 190

  Fly   244 -FILYTFFLGFATPLCFILSFYYLVIRKL-RSVGPKPGTKSKEKRRAHRKVTRLVLTVISVYILC 306
             .:|....||:..||..||..|..:..|| |:....|.|   ||...::|....::.:|.|::||
  Rat   191 WILLGACLLGYVLPLAIILLCYSQICCKLFRTAKQNPLT---EKSGVNKKALNTIILIIGVFVLC 252

  Fly   307 WLPHWIS----QVALIHSNPAQRDLSRLEILIFL-LLGALVYSNSAVNPILYAFLSENFRKSFFK 366
            :.|:.::    .|..:::..|.....|....|.| ....|:..|..::|.:|.|..:.:::...|
  Rat   253 FTPYHVAIMQHMVKTLYAPGALGCGVRHSFQISLHFTVCLMNFNCCMDPFIYFFACKGYKRKVMK 317

  Fly   367 AFTCMNKQDINAQLQLEPSVFTKQGSKKRGGSKRLLTS 404
                |.|:.::..:........::.|::...|:.::.|
  Rat   318 ----MLKRQVSVSISSAVRSAPEENSREMTESQMMIHS 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 73/291 (25%)
7tm_1 94..353 CDD:278431 66/270 (24%)
Gpr183NP_001102856.1 7tm_4 39..>157 CDD:304433 33/118 (28%)
7tm_1 44..304 CDD:278431 66/270 (24%)
Interaction with G proteins. {ECO:0000250} 122..130 5/8 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.