DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstC-R1 and hcar1-1

Sequence 1:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001156764.1 Gene:hcar1-1 ZFINID:ZDB-GENE-111111-4 Length:328 Species:Danio rerio

Alignment Length:360 Identity:76/361 (21%)
Similarity:141/361 (39%) Gaps:78/361 (22%)


  Fly    89 IIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPFLL-YTMRICSWRFGEFMCKAY 152
            ::||.||.|.:.:...........:||:.:||:||...|..:||.. |..|...|.:|:..|:..
Zfish    29 VLGLMGNGLALCMFFFHRDSWKPNSIYLAHLALADSLVLFCLPFRADYYRRGKHWVYGDAFCRVL 93

  Fly   153 MVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPVIL---- 213
            :...:........||..::.|||:.:.||::......|..|..||...|  :.::.:.|.|    
Zfish    94 LFLLAANRAAGIFFLTAVAVDRYLKIVHPLNRINQMGLRYALWVSVGLW--ALIIAMTVYLLADK 156

  Fly   214 ---YASTVEQEDGIN----YSCNIMWPDAYKKHSGTTFILYTFFLGFATPLCFILSFYYLVIRKL 271
               |.:...|.:..|    ::....|.:::            :.:.|..|...::.....:..:|
Zfish   157 HFYYRNNRTQCESFNICLGHNALSDWHNSF------------YVIQFFVPTFIVIYCSTCITWQL 209

  Fly   272 RSVGPKPGTKSKEKRRAHRKVTRLVLTVISVYILCWLPHWISQVA--LIHS--NPAQ--RDLSRL 330
            :.       |:.:|....::..|.||.|..|:|:|:.|..:|::|  ::.|  |..|  :|.:  
Zfish   210 KG-------KTIDKHGKIKRAVRFVLAVALVFIICFFPSNVSRIAVWVLKSWHNECQYFQDAN-- 265

  Fly   331 EILIFLLLGALVYSNSAVNPILYAFLSENFRKSFFKAFTCMNKQDINAQLQLEPSVFTKQGSKKR 395
              :.|.:.....|.||.:||::|.|.|....:|..|.:..|:.|.|..:                
Zfish   266 --VAFYITVCFTYFNSVLNPVVYYFSSPAVSRSLRKIYMRMSGQKIEDE---------------- 312

  Fly   396 GGSKRLLTSNPQIPPLLPLNAGNNNSSTTTSSTTT 430
                               :..||:||.|.|:..:
Zfish   313 -------------------HEKNNHSSVTVSANVS 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 67/297 (23%)
7tm_1 94..353 CDD:278431 60/277 (22%)
hcar1-1NP_001156764.1 7tm_1 34..286 CDD:278431 60/277 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.833 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.