DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstC-R1 and LOC564730

Sequence 1:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_021325700.1 Gene:LOC564730 ID: Length:310 Species:Danio rerio

Alignment Length:292 Identity:86/293 (29%)
Similarity:137/293 (47%) Gaps:40/293 (14%)


  Fly    83 LYGFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPFLL-YTMRICSWRFGE 146
            :|..|.::||.||...:|..:...:.::.:||||:||||||..||..:||.: |.:...:|.||:
Zfish    25 VYILVLVLGLIGNLGALYYFIFKIQQKSPSNIYIINLAVADTLFLFALPFRIHYHLNDSNWIFGD 89

  Fly   147 FMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPV 211
            .||:..........:.|..|:..:..|||||..||.:..|.|...:..:||...|..|...||..
Zfish    90 AMCRITGTIFFANMYISITFMTCICVDRYIATLHPHTYLRLRNTWLTALVSGAVWLVSGSAMLAF 154

  Fly   212 ILYA--STVEQE--DGINYSCNIMWPDAYKKHSGTTFILYTFFLGFATPLCFILSFYYLVIRKLR 272
            :|..  ||.|:.  :|..   :..|.|.      ..:.:.:...|...|...||..|.||..:: 
Zfish   155 MLTCPLSTKEKMCFEGFT---SKEWSDL------APYSVCSLIFGSLLPSVVILVCYPLVAHRI- 209

  Fly   273 SVGPKPGTKSKEKRRAHRKVTRLVLTVISVYILCWLPHWISQVALIHSNPAQRDLSRL------E 331
                     |:.|....|...|::..::::.|||:||:.:  |.|:|.      ||||      :
Zfish   210 ---------SQIKNSTARGARRIIYAILAITILCFLPYHV--VHLVHL------LSRLSENQEDD 257

  Fly   332 ILIFL--LLGALVYSNSAVNPILYAFLSENFR 361
            .:.||  :..|||..||.::||||.|.:.:::
Zfish   258 WIYFLRRVTMALVSLNSLLDPILYYFATGHYK 289

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 84/288 (29%)
7tm_1 94..353 CDD:278431 80/272 (29%)
LOC564730XP_021325700.1 7tmA_purinoceptor-like 20..285 CDD:320113 86/287 (30%)
TM helix 1 20..47 CDD:320113 7/22 (32%)
TM helix 2 54..79 CDD:320113 15/25 (60%)
TM helix 3 92..122 CDD:320113 8/30 (27%)
TM helix 4 134..154 CDD:320113 6/20 (30%)
TM helix 5 179..208 CDD:320113 7/35 (20%)
TM helix 6 220..245 CDD:320113 8/27 (30%)
TM helix 7 260..285 CDD:320113 12/25 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.