DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstC-R1 and sstr1b

Sequence 1:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_005172275.1 Gene:sstr1b ZFINID:ZDB-GENE-120410-2 Length:371 Species:Danio rerio

Alignment Length:344 Identity:134/345 (39%)
Similarity:201/345 (58%) Gaps:46/345 (13%)


  Fly    29 YNTNESLYTTELNHRWISGSSTIQPEESLYGTDLP-----TYQHCIATRNSFADLFTVV---LYG 85
            ||.|||.                     :..||||     .|::    ..|..|...::   :|.
Zfish     7 YNGNESF---------------------MLATDLPFNSTGDYEY----YESEPDASKIIIPSIYA 46

  Fly    86 FVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPFLLYTMRICSWRFGEFMCK 150
            .||.||:.||.:||||:|:::||:|.|||||||||:|||.|::.:|||..:..:..|.||..||:
Zfish    47 LVCCIGVTGNAMVIYVILKYAKMKTATNIYILNLAIADELFMLSVPFLATSAAVHHWPFGSLMCR 111

  Fly   151 AYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPVILYA 215
            ..:....|..|||...|.::|.||||||.|||.:.|||...:||||:...|..|.:::||:|::|
Zfish   112 LVLSVDGINMFTSIFCLTVLSVDRYIAVVHPIKAARYRRPTVAKVVNVCVWGLSLLVILPIIIFA 176

  Fly   216 STVEQEDGINYSCNIMWPDAYKKHSGTTFILYTFFLGFATPLCFILSFYYLVIRKLRSVGPKPGT 280
            .||..:|| ...||.|||::....:   |::|||.|||..|:..|...|.|::.::|:||.|.|.
Zfish   177 DTVPAQDG-GVDCNFMWPESSWSEA---FVVYTFLLGFLLPVGAICLCYCLIVVRMRAVGLKAGW 237

  Fly   281 KSKEKRRAHRKVTRLVLTVISVYILCWLPHWISQVALIHSNPAQRDLSRLEILIFLLLGALVYSN 345
              .::||:.:|:||:||.|::|::|||:|.:|.|:..:...|....:::|.::       |.|:|
Zfish   238 --LQRRRSEKKITRMVLLVVAVFVLCWMPFYIVQLISVFRKPPDPMVTQLFVI-------LSYAN 293

  Fly   346 SAVNPILYAFLSENFRKSF 364
            |..|||||.|:|:|||:||
Zfish   294 SGANPILYGFVSDNFRRSF 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 120/278 (43%)
7tm_1 94..353 CDD:278431 109/259 (42%)
sstr1bXP_005172275.1 7tm_4 47..>198 CDD:304433 72/152 (47%)
7tm_1 55..301 CDD:278431 109/259 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BCR0
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I2952
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000204
OrthoInspector 1 1.000 T128570
orthoMCL 1 0.900 OOG5_132895
Panther 1 1.100 O PTHR24229
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3938
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.