DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstC-R1 and AstA-R1

Sequence 1:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_524700.1 Gene:AstA-R1 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster

Alignment Length:449 Identity:126/450 (28%)
Similarity:192/450 (43%) Gaps:108/450 (24%)


  Fly    15 GEMTADSEANATNWYNTNESLYTTELNHRWISGSSTIQPEESL-YGTDLPTYQHCIATRNSFADL 78
            |.:.:.|.::..|:..|:|  :|...:|         ...:|: |..:....:..::|       
  Fly    29 GSIISVSNSSGNNYAFTSE--HTDHSDH---------NANDSMEYDAESVALERIVST------- 75

  Fly    79 FTVVLYGFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLI-GIPFLLYTMRICSW 142
            ...|.:|.:...||.||.|||.||:...:|::.||:.|:||||:|..|:| .:||......:..|
  Fly    76 IVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEW 140

  Fly   143 RFGEFMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVL 207
            .||...||.......:|...|...|::||.||::||.||::|...||...|.:....||.|....
  Fly   141 PFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTT 205

  Fly   208 MLPVILYASTVEQEDGINYSCNIMWPDAYKKHSGTTFILYT-------------FFL-GFATPLC 258
            .:||.|           ::|..|.   .|..::||..:..|             ||| .:..||.
  Fly   206 AIPVAL-----------SHSVRIY---QYHGNAGTACVFSTEEEIWSLVGFQVSFFLSSYVAPLT 256

  Fly   259 FILSFYYLVIRKLRSVGP--KPGTKSKEKRRAHRKVTRLVLTVISVYILCWLPHWISQVALIHSN 321
            .|...|..::.:|....|  ||   |.|.|:..|:|||:|:.|:..:.:||||        ||..
  Fly   257 LICFLYMGMLARLWKSAPGCKP---SAESRKGKRRVTRMVVVVVLAFAICWLP--------IHVI 310

  Fly   322 PAQRDL-----SRLEILIFLLLGALVYSNSAVNPILYAFLSENFRKSFFKAFTCMNKQDINAQLQ 381
            ...:.|     |.|.::|.::...:.|:||.:|||||||||:||||:|.|...|           
  Fly   311 LVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWC----------- 364

  Fly   382 LEPSVFTKQGSKKRGGSKRLLTSNPQIPPLLPLNAGNNNSSTTTSSTTTAEKTGTTGTQ 440
                           ||...|.:|.|:                |.:|.||...||:..:
  Fly   365 ---------------GSPPPLMTNQQV----------------TKTTRTATGNGTSNIE 392

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 102/302 (34%)
7tm_1 94..353 CDD:278431 89/281 (32%)
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 54/171 (32%)
7tm_1 91..347 CDD:278431 89/281 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24229
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.