DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstC-R1 and oprd1b

Sequence 1:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_997920.2 Gene:oprd1b ZFINID:ZDB-GENE-030131-8473 Length:375 Species:Danio rerio

Alignment Length:352 Identity:124/353 (35%)
Similarity:185/353 (52%) Gaps:33/353 (9%)


  Fly    44 WISGSSTIQPEESLYGTDLPTYQHCIATRNSFADLFTV---VLYGFVCIIGLFGNTLVIYVVLRF 105
            |..|||.::                 |.|.|.|....|   .||..:|::||.||.||:|.|:|:
Zfish    35 WSGGSSELK-----------------AVRGSSAVAIAVSITALYSVICVVGLVGNVLVMYGVVRY 82

  Fly   106 SKMQTVTNIYILNLAVADECFLIGIPFLLYTMRICSWRFGEFMCKAYMVSTSITSFTSSIFLLIM 170
            :||:|.|||||.|||:||......:||......:.:|.|||.:||..:.......|||...|.:|
Zfish    83 TKMKTATNIYIFNLALADALATSTLPFQSAKYLMGTWPFGELLCKVVIAIDYYNMFTSIFTLTMM 147

  Fly   171 SADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPVILYASTVEQEDGINYSCNIMWPDA 235
            |.|||||||||:.:..:||...||:::...|..|:.:..||::.|.|.|.:.| ...|.:.:||.
Zfish   148 SVDRYIAVCHPVRALDFRTPVKAKIINICVWILSSAVGFPVMVMAVTKELDSG-KTICMLKFPDP 211

  Fly   236 YKKHSGTTFILYTFFLGFATPLCFILSFYYLVIRKLRSVGPKPGTKSKEKRRAHRKVTRLVLTVI 300
             :.:..|...:..|...|..|:..|...|.|:|.:|:||....|  ||||.|..|::||:||.|:
Zfish   212 -EWYWDTVTKICVFIFAFVFPVLVITVCYGLMILRLKSVRLLSG--SKEKDRNLRRITRMVLVVV 273

  Fly   301 SVYILCWLPHWISQVALIHSNPAQRDLSRLEILIFLLLGALVYSNSAVNPILYAFLSENFRKSFF 365
            :.:|:||.|..|..:........|::|  |.:..:.|..||.|.||::||:|||||.|||::   
Zfish   274 AAFIICWTPIHIFIIVKTVVEIDQKNL--LVVACWHLCIALGYMNSSLNPVLYAFLDENFKR--- 333

  Fly   366 KAFTCMNKQDINAQLQLEPSVFTKQGS 392
                |..:..:..:.::|.:.|:|..|
Zfish   334 ----CFREFCLPFRTRIEQNSFSKARS 356

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 108/280 (39%)
7tm_1 94..353 CDD:278431 98/259 (38%)
oprd1bNP_997920.2 7tm_1 76..324 CDD:278431 94/254 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24229
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.