DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstC-R1 and lpar5a

Sequence 1:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_955900.1 Gene:lpar5a ZFINID:ZDB-GENE-030131-1193 Length:328 Species:Danio rerio

Alignment Length:304 Identity:79/305 (26%)
Similarity:142/305 (47%) Gaps:38/305 (12%)


  Fly    75 FADLFTVVLYGFVCIIGLFGNTLVIYV-VLRFSKMQTVTNIYILNLAVADECFLIGIPFLLYTMR 138
            |...:||||     :..|..|.:.::: |.|....::|..||:.|||::|..|.:.:||.:....
Zfish    21 FTSTYTVVL-----LFALPLNCVSLWILVCRNGLKKSVPVIYMANLALSDLLFTLSLPFRIIYFA 80

  Fly   139 ICSWRFGEFMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWST 203
            ...|..|..:|.......::..::||.|::::|.||.:||.:|:.|...||..:|.:..|:.|..
Zfish    81 TGKWTLGNTLCMIPGTLFAVNIYSSSFFIMLISVDRMLAVVYPLRSRSLRTAPVAWMFCALVWLL 145

  Fly   204 SAVLMLPVILYASTVEQEDGIN-YSCNIMWPDAYKKHS------GTTFILYTFFLGFATPLCFIL 261
            .|.|.:|:      .:....|| .:|||  ...::|:|      |...|....|.|...|...||
Zfish   146 IAGLAVPI------AQNHPEINDTACNI--TRCFEKYSTDSWNNGFKLICLATFFGMLVPFSIIL 202

  Fly   262 SFYYLVIRKLRSVGPKPGTKSKEKRRAHRKVTRLVLTVISVYILCWLPHWI-------SQVALIH 319
            .....|:|:||  |....|.|.....:..|:.:|.|:.:.:|.:|::|..:       .::.::|
Zfish   203 GCTVAVVRQLR--GYSMATSSFNAELSKSKIVKLFLSNLLIYTICFIPFHVIYILFTLVKLEMLH 265

  Fly   320 SNPAQRDLSRLEILIFL--LLGALVYSNSAVNPILYAFLSENFR 361
            :.      |.||:...|  :...|..:||.::|::|.|.::|.:
Zfish   266 NG------SHLEVYFNLHNITLCLASTNSCLDPLIYYFSAKNIQ 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 74/292 (25%)
7tm_1 94..353 CDD:278431 70/276 (25%)
lpar5aNP_955900.1 7tm_1 36..295 CDD:278431 70/275 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.