DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstC-R1 and Gpr87

Sequence 1:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_006232463.1 Gene:Gpr87 RGDID:1307852 Length:358 Species:Rattus norvegicus

Alignment Length:364 Identity:85/365 (23%)
Similarity:155/365 (42%) Gaps:48/365 (13%)


  Fly    32 NESLYTTELNHRWISGSSTIQPEESLYGTDLPTYQHCIATRNSFADLFTVVLYGFVCIIGLFGNT 96
            || || ::.:|   :.:|||:      |....:..|     |.|..:...|||..:.:..:..|.
  Rat    13 NE-LY-SQASH---TANSTIE------GHGKNSTHH-----NEFDTIILPVLYLVIFVASILLNG 61

  Fly    97 LVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPF-LLYTMRICSWRFGEFMCKAYMVSTSITS 160
            |.:::.... :.:|....|:.|:.|||....:..|| ::.......|.|...:|:...|......
  Rat    62 LAVWIFFHI-RNKTSFIFYLKNIVVADLIMTLTFPFRIVRDAGFGPWYFEFILCRYTSVLFYANM 125

  Fly   161 FTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPVILYASTVEQEDGIN 225
            :||.:||.::|.|||:.|..|....|..::...||:|...|...|||.||.|:..:....::.|:
  Rat   126 YTSIVFLGLISVDRYLKVVKPFGDSRMYSITFTKVLSICVWVIMAVLSLPNIILTNGQPTKENIH 190

  Fly   226 YSCNIMWPDAYKKHSGTTFILYTFFLGFATPLCFILSFYYLVIRKLRSVGPKPGTKSKEKRRAHR 290
            ....:..|...|.....|::....|:..   |..::..|..:.|.:.....:..::|..||: |.
  Rat   191 DCMKLKSPLGAKWDMAVTYVDSCLFVAV---LVILIGCYIAISRYIHKSSRQFISQSSRKRK-HN 251

  Fly   291 KVTRLVLTVISVYILCWLPHWISQVALIHSNPAQRDLSRL-------------EILIFLLLGALV 342
            :..|:   |::|:..|:||:.:.::....|:     |.||             |:.:||..    
  Rat   252 QSIRV---VVAVFFTCFLPYHLCRIPFTFSH-----LDRLLDDSAHKILHYCKEMTLFLSA---- 304

  Fly   343 YSNSAVNPILYAFLSENFRKSFFKAFTCMNKQDINAQLQ 381
             .|..::||:|.|:.::|.:..||......:.:....||
  Rat   305 -CNVCLDPIIYFFMCKSFSRRLFKKSNIRTRSESIRSLQ 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 68/294 (23%)
7tm_1 94..353 CDD:278431 63/273 (23%)
Gpr87XP_006232463.1 7tm_4 57..>168 CDD:304433 29/112 (26%)
7tm_1 60..314 CDD:278431 63/272 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.