DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstC-R1 and Ptgdr2

Sequence 1:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001012070.1 Gene:Ptgdr2 RGDID:1311986 Length:403 Species:Rattus norvegicus

Alignment Length:393 Identity:101/394 (26%)
Similarity:172/394 (44%) Gaps:60/394 (15%)


  Fly    50 TIQP-----EESLYGTDLPTYQHCIATRNS---FADLFTVVLYGFVCIIGLFGNTLVIYVV---L 103
            |::|     ||.:   .||.:.      ||   :.|..:|:|:|...::||..|.|:::||   :
  Rat     5 TLKPLCPLLEEMV---QLPNHS------NSSLRYIDHVSVLLHGLASLLGLVENGLILFVVGCRM 60

  Fly   104 RFSKMQTVTNIYILNLAVADECFLIGIPFLLYTMRI-CSWRFGEFMCKAYMVSTSITSFTSSIFL 167
            |    |||...::|:||::|......:||..|.:.: .||..|...||.:.....:..|.|...|
  Rat    61 R----QTVVTTWVLHLALSDLLAAASLPFFTYFLAVGHSWELGTTFCKLHSSVFFLNMFASGFLL 121

  Fly   168 LIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPVILYASTVEQEDG---INYSCN 229
            ..:|.||.:.|..|:.:..:||:..|..|..:.|:.:.:..:|..::..|:.:.||   ..|:..
  Rat   122 SAISLDRCLQVVRPVWAQNHRTVAAAHRVCLMLWALAVLNTVPYFVFRDTIPRRDGRIMCYYNML 186

  Fly   230 IMWP----DAYKKHSGTTFILYTFFLGFATPLCFILSFYYLVIRKLRSVGPKPGTKSKEKRRAHR 290
            ::.|    |....:......:..|.|.|..||..|.|.:..|..:|...|         ::|..|
  Rat   187 LLNPGSDRDTTCDYRQKALAVSKFLLAFMVPLAIIASSHVAVSLQLHHRG---------RQRTGR 242

  Fly   291 KVTRLVLTVISVYILCWLPHWISQV--ALIHSNPAQRDLSRLEILIFLLLGALVYSNSAVNPILY 353
            .| |||..::..:||||.|:.|..:  |..||....|.|:...:   ..:.:|.:.||.|||:||
  Rat   243 FV-RLVAAIVVAFILCWGPYHIFSLLEARAHSVTTLRQLASRGL---PFVTSLAFFNSVVNPLLY 303

  Fly   354 AF----LSENFRKSFFKAFTCMNKQDINAQLQLEPSVFTKQGSKKRGGS-----KRLLTSN--PQ 407
            ..    :....|:|.......:..:|  :.|...|....::..::|..|     ..||.::  ||
  Rat   304 VLTCPDMLHKLRRSLLTVLESVLVED--SDLSTGPGKRCRRRHRRRASSTTTPASTLLLADRFPQ 366

  Fly   408 IPP 410
            :.|
  Rat   367 LRP 369

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 79/297 (27%)
7tm_1 94..353 CDD:278431 74/272 (27%)
Ptgdr2NP_001012070.1 7tm_1 84..303 CDD:278431 62/232 (27%)
Involved in the recycling of CRTH2. {ECO:0000250} 329..332 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24229
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.