DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstC-R1 and Oxgr1

Sequence 1:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_997471.1 Gene:Oxgr1 RGDID:1303155 Length:337 Species:Rattus norvegicus

Alignment Length:361 Identity:98/362 (27%)
Similarity:155/362 (43%) Gaps:53/362 (15%)


  Fly    18 TADSEANATNWYNTNESLYTTELNHRWISGSSTIQPEESLYGTDLPTYQHCIATRNSFADLFTVV 82
            |.||.||.:::.:     |.|.|                         ::|...:.||...:..|
  Rat     4 TLDSPANDSDFLD-----YITAL-------------------------ENCTDEQISFKMQYLPV 38

  Fly    83 LYGFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPFLL-YTMRICSWRFGE 146
            :|..:.::|..|||:.|.:.:...:....:.|.:||||:.|..:|..:|||: |.....:|.||:
  Rat    39 IYSIIFLVGFPGNTVAISIYVFKMRPWKSSTIIMLNLALTDLLYLTSLPFLIHYYASGENWIFGD 103

  Fly   147 FMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPV 211
            ||||..........::|.:||...|..|||.:.||:|....:....|.|..|..|..|.|.::|:
  Rat   104 FMCKFIRFGFHFNLYSSILFLTCFSLFRYIVIIHPMSCFSIQKTRWAVVACAGVWVISLVAVMPM 168

  Fly   212 -ILYASTVEQEDGINYSCNIMWPDAYKKHSGTTFILYTFFL---GFATPLCFILSFYYLVIRKLR 272
             .|..||..    .|.|..:   |.......||...|...|   .|..||..:...|..:|..| 
  Rat   169 TFLITSTTR----TNRSACL---DLTSSDDLTTIKWYNLILTATTFCLPLLIVTLCYTTIISTL- 225

  Fly   273 SVGPKPGTKSKEKRRAHRKVTRLVLTVISVYILCWLPHWISQVALIHSNPAQRDLSRLEILI--- 334
            :.||:..:..|:|.|      ||.:.::.|:.:|:||..|.:|..|.|.......| :|..|   
  Rat   226 THGPRTHSCFKQKAR------RLTILLLLVFYVCFLPFHILRVIRIESRLLSISCS-IESHIHEA 283

  Fly   335 FLLLGALVYSNSAVNPILYAFLSENFRKSFFKAFTC 370
            :::...|...|:..|.:||..:|.||:::|..|..|
  Rat   284 YIVSRPLAALNTFGNLLLYVVVSNNFQQAFCSAVRC 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 84/288 (29%)
7tm_1 94..353 CDD:278431 77/267 (29%)
Oxgr1NP_997471.1 7tm_1 50..302 CDD:278431 77/267 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.