DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AstC-R1 and Mchr1

Sequence 1:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_660114.1 Gene:Mchr1 MGIID:2180756 Length:353 Species:Mus musculus

Alignment Length:305 Identity:101/306 (33%)
Similarity:162/306 (53%) Gaps:30/306 (10%)


  Fly    71 TRN-SFADLFTVVLYGFVCIIGLFGNTLVIYVVLRFSKM---QTVTNIYILNLAVADECFLIGIP 131
            ||: |:.::....::|.:|::|:.||:.||:.|::.||:   ..|.:|:|:||:|.|..||:|:|
Mouse    33 TRSVSYINIIMPSVFGTICLLGIVGNSTVIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMP 97

  Fly   132 FLLY-TMRICSWRFGEFMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKV 195
            |::: .|....|.|||.||.......:.:.|||:..|..|:.|||:|..|||||.::|...:|.:
Mouse    98 FMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSMATL 162

  Fly   196 VSAIAWSTSAVLMLPVILYASTVEQEDGINYSCNIMWP----DAYKKHSGTTFILYTFFLGFATP 256
            |..:.|:.|.:.:.||.|||..:....|. ..|.|..|    |.|      .|.||.|||.||.|
Mouse   163 VICLLWALSFISITPVWLYARLIPFPGGA-VGCGIRLPNPDTDLY------WFTLYQFFLAFALP 220

  Fly   257 LCFILSFYYLVIRKL-RSVGPKPGTKSKEKRRAHRKVTRLVLTVISVYILCWLPHWISQVALIHS 320
            ...|.:.|..::::: .||.|   ...:..|...::|||..:.:..|:.:||.|:::.|:     
Mouse   221 FVVITAAYVKILQRMTSSVAP---ASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQL----- 277

  Fly   321 NPAQRDLSRLEILIFLLLGALV---YSNSAVNPILYAFLSENFRK 362
              .|..:||..:....|..|.:   |:||.:||.:|..|.|.|||
Mouse   278 --TQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRK 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 97/288 (34%)
7tm_1 94..353 CDD:278431 89/271 (33%)
Mchr1NP_660114.1 7tmA_MCHR1 41..322 CDD:320460 98/298 (33%)
TM helix 1 42..68 CDD:320460 8/26 (31%)
TM helix 2 78..104 CDD:320460 11/26 (42%)
TM helix 3 116..146 CDD:320460 10/30 (33%)
TM helix 4 158..178 CDD:320460 5/20 (25%)
TM helix 5 205..234 CDD:320460 12/35 (34%)
TM helix 6 249..279 CDD:320460 8/37 (22%)
TM helix 7 290..315 CDD:320460 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24229
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.